Cat: PA1000-22DB

Recombinant Human ACAA1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ACAA1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ACAA1;ACAA;PTHIO;3-ketoacyl-CoA thiolase. peroxisomal

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P09110

  • Expression Region

    27-424aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMLSGAPQASAADVVVVHGRRTAICRAGRGG FKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQ FLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSL ADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALA SQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTME GLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLR SYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYC VEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVV SMCIGTGMGAAAVFEYPGN

  • Molecular Weight

    44 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ACAA1, or Acetyl-CoA Acyltransferase 1, plays a crucial role in fatty acid metabolism, particularly in the final steps of mitochondrial fatty acid oxidation. This enzyme catalyzes the conversion of 3-ketoacyl-CoA to acetyl-CoA and acyl-CoA, which are vital intermediates in energy production. Research has shown that ACAA1 is essential for maintaining cellular energy homeostasis and regulating lipid metabolism. Mutations or dysregulation of ACAA1 have been implicated in various metabolic disorders, including mitochondrial diseases and obesity-related conditions. Understanding the structure and function of the ACAA1 recombinant protein provides insights into its enzymatic mechanisms and potential therapeutic applications. Recent studies focus on characterizing the recombinant form of ACAA1 through techniques such as crystallography and enzymatic assays, aiming to elucidate its catalytic properties and interaction with cofactors. These investigations not only enhance our understanding of fatty acid metabolism but also pave the way for developing targeted treatments for metabolic diseases associated with ACAA1 dysfunction. As a result, ACAA1 has gained significant interest in biochemical research, highlighting its potential as a biomarker and target for drug development.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US