Analytical Data
-
Gene name
FOLR4
- Application
-
Alternative Names
FOLR4;FOLR4;JUNO;Sperm-egg fusion Protein Juno
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A6ND01
-
Expression Region
20-250aa
-
AA Sequence
GDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFASSAPSWELSYTIMVCSLFLPFLS
-
Molecular Weight
30.3kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FOLR4, or Folate Receptor 4, is a member of the folate receptor family and plays a crucial role in the uptake of folate, which is essential for cellular processes such as DNA synthesis and repair. Elevated expression of FOLR4 has been observed in various cancers, making it a potential biomarker for tumor identification and a target for therapeutic intervention. The interest in FOLR4-recombinant proteins arises from their potential application in drug delivery systems and cancer treatment. These proteins can be engineered to selectively bind to FOLR4-expressing cells, thereby enhancing the specificity of drug delivery and minimizing off-target effects. Research into FOLR4 recombinant proteins involves strategies for their production, purification, and functional validation, focusing on enhancing their binding affinity and therapeutic efficacy. Additionally, the use of FOLR4 as a target for antibody-drug conjugates is being explored, which could lead to innovative approaches in targeted cancer therapy. Understanding the structure-function relationships of FOLR4 and the development of recombinant proteins can pave the way for novel treatment strategies that leverage the unique properties of this receptor. Furthermore, studying the interactions between FOLR4 and its ligands could provide insights into its role in tumor biology and the tumor microenvironment, ultimately contributing to the advancement of personalized medicine approaches in oncology. As research progresses, the characterization and application of FOLR4 recombinant proteins hold promise for improving cancer diagnostics and therapeutics.











