Analytical Data
-
Gene name
ABI3
- Application
-
Alternative Names
ABI3;NESH;ABI gene family member 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9P2A4
-
Expression Region
1-366aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMAELQQLQEFEIPTGREALRGNHSALL RVADYCEDNYVQATDKRKALEETMAFTTQALASVAYQVGNLAGHTLRMLD LQGAALRQVEARVSTLGQMVNMHMEKVARREIGTLATVQRLPPGQKVIAP ENLPPLTPYCRRPLNFGCLDDIGHGIKDLSTQLSRTGTLSRKSIKAPATP ASATLGRPPRIPEPVHLPVVPDGRLSAASSASSLASAGSAEGVGGAPTPK GQAAPPAPPLPSSLDPPPPPAAVEVFQRPPTLEELSPPPPDEELPLPLDL PPPPPLDGDELGLPPPPPGFGPDEPSWVPASYLEKVVTLYPYTSQKDNEL SFSEGTVICVTRRYSDGWCEGVSSEGTGFFPGNYVEPSC
-
Molecular Weight
41 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ABI3, or ABA-insensitive 3, is a pivotal regulatory protein that plays a crucial role in seed development and germination in plants, particularly in response to abscisic acid (ABA), a hormone regulating various physiological processes. The understanding of ABI3 is rooted in its involvement in abiotic stress responses, especially in how plants manage drought conditions and other environmental stresses. Researchers first identified ABI3 in Arabidopsis thaliana, where mutations in this gene resulted in seeds that failed to mature and germinate properly, highlighting its role in seed dormancy and desiccation tolerance. Further investigations revealed that ABI3 acts as a transcription factor, regulating a spectrum of downstream genes involved in seed maturation and stress response pathways. With the growing need for crops resilient to climate change, studies on ABI3 and its signaling pathways have gained momentum, as enhancing its function could lead to improved agricultural practices. Increasingly, the molecular mechanisms through which ABI3 interacts with other proteins and genetic elements are being explored, revealing complex regulatory networks that govern seed physiology. Thus, ABI3 not only serves as a fundamental research topic in plant biology but also as a potential target for biotechnological approaches aimed at developing crops with better survival rates in adverse conditions. The advancements in genomic technologies, such as CRISPR and RNA-seq, facilitate deeper insights into ABI3 functions, offering promising avenues for future agricultural innovations.











