Analytical Data
-
Gene name
GGACT
- Application
-
Alternative Names
GGACT；A2LD1；Gamma-glutamylaminecyclotransferase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NVV5
-
Expression Region
全长
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMALVFVYGTLKRGQPNHRVLRDGAHGSAAF RARGRTLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAVDERMLRFLDD FESCPALYQRTVLRVQLLEDRAPGAEEPPAPTAVQCFVYSRATFPPEWAQ LPHHDSYDSEGPHGLRYNPRENR
-
Molecular Weight
19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on GGACT recombinant proteins is rooted in the growing demand for innovative biopharmaceuticals and advanced molecular therapies. GGACT, which stands for a specific sequence of genes encoding proteins with potential therapeutic applications, has drawn attention due to its unique structural and functional properties. Studies have shown that these recombinant proteins can exhibit enhanced biological activities, such as improved solubility, stability, and interactions with biological targets. The manipulation of GGACT sequences through recombinant DNA technology allows for the expression of these proteins in host systems, enabling large-scale production and purification. Understanding the mechanisms underlying GGACT protein expression and function is crucial for developing targeted therapies for various diseases, including cancer and metabolic disorders. Additionally, the application of GGACT proteins in vaccine development and as therapeutic agents further highlights their significance in contemporary biomedical research. As such, ongoing investigations aim to elucidate the intricate relationships between GGACT proteins and cellular processes, paving the way for their potential clinical applications and contribution to personalized medicine.
