Analytical Data
-
Gene name
YWHAH
- Application
-
Alternative Names
YWHAH；YWHA1；14-3-3 Protein eta
-
Species
Human
-
Source
E. coli
-
Tag
C-his
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q04917
-
Expression Region
4-246aa
-
AA Sequence
REQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN
-
Molecular Weight
51.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
YWHAH, or 14-3-3 protein epsilon, is a member of the 14-3-3 protein family, which plays a crucial role in various cellular processes, including signal transduction, cell cycle regulation, and apoptosis. These proteins act as scaffolding molecules, facilitating the interaction between various signaling pathways and their target proteins. The study of YWHAH has garnered significant attention due to its involvement in multiple biological functions and its association with several diseases, including cancer and neurodegenerative disorders. Research indicates that YWHAH can modulate the activity of numerous proteins involved in critical pathways such as the MAPK and PI3K/AKT pathways. Furthermore, dysregulation of YWHAH expression has been linked to pathophysiological conditions, highlighting its potential as a therapeutic target. Recent studies have focused on the structural characterization of YWHAH, as understanding its three-dimensional conformation can provide insights into its functional mechanisms. Additionally, recombinant YWHAH proteins are being utilized in various biochemical assays to investigate protein-protein interactions and to explore its role in cellular signaling networks. Overall, research on YWHAH is pivotal for unraveling the complexities of cellular signaling and could lead to novel therapeutic strategies for diseases where YWHAH is implicated.
