Analytical Data
-
Gene name
FGF-14
-
简介
Fibroblast growth factor 14 is a bioactive protein found in the brain and pituitary gland that promotes fibroblast growth and is involved in embryonic development, angiogenesis, tissue repair and other processes. FGF-14 plays a neuroprotective role in in vitro Alzheimer's disease (AD) models by inhibiting MAPK signaling. FGF-14 Protein, Canine is the recombinant canine-derived FGF14 protein, expressed by E. coli , with tag free.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. When Recombinant Canine FGF14 is present at 2 μg/mL, can bind Recombinant Human FGFR4. The ED50 for this effect is 299.1 ng/mL. Measured by its binding ability in a functional ELISA. When Recombinant Canine FGF14 is present at 2 μg/mL, can bind Recombinant Human FGFR4.The ED50 for this effect is 299.1 ng/mL.
-
Alternative Names
Fibroblast growth factor 14; FHF-4; FGF14
-
Species
Canine
-
Source
E. coli
-
Tag
Tag Free
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
XP_003363267.1
-
Expression Region
K64-T252
-
AA Sequence
KNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQVMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKAGVTPSKSTSASAIMNGGKPVNKSKTT
-
Protein Length
Partial
-
Molecular Weight
21 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Fibroblast growth factor 14 (FGF-14) is a member of the fibroblast growth factor family, which includes various proteins involved in critical biological processes such as cell proliferation, differentiation, and survival. Notably, FGF-14 has garnered attention due to its unique expression pattern in the brain, particularly in regions associated with neuronal development and plasticity. Its role in synaptic function and modulation of ion channels suggests that FGF-14 may be integral to neurological processes, including learning and memory. Emerging studies have indicated that mutations or dysregulation of FGF-14 could be linked to various neurological disorders, making it a potential therapeutic target. The recombinant protein production of FGF-14 allows researchers to investigate its structure-function relationship, engage in functional assays, and explore its interactions with cellular receptors. Understanding FGF-14's mechanism of action at the molecular level could pave the way for novel interventions in neurodegenerative diseases and other conditions where FGF-14 is implicated. As a result, the research surrounding FGF-14 recombinant protein contributes significantly to the broader field of neuroscience, underscoring the need for more in-depth studies to unravel its complex biological roles.
