Cat: IPD-X12150

Recombinant Canine FGF-12 Protein

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FGF-12

  • 简介

    FGF-12 forms complexes with signaling proteins regulates the cytoskeletal system, binds to FGF receptors, activates signaling cascades to prevent apoptosis and interacts with ribosome biogenetic complexes. FGF-12 has been linked to neurological diseases, cancer and heart disease, making it a potential target and therapeutic agent for gene therapy. FGF-12 Protein, Canine is the recombinant canine-derived FGF-12 protein, expressed by E. coli , with tag free.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. Immobilized FGFR4 at 2 μg/mL (100 μL/well) can bind Biotinylated FGF-12. The ED50 for this effect is 1.505 µg/mL. Measured by its binding ability in a functional ELISA. Immobilized FGFR4 at 2 μg/mL (100 μL/well) can bind Biotinylated S FGF-12 . The ED50 for this effect is 1.505 µg/mL.

  • Alternative Names

    Fibroblast growth factor 12; FGF-12; FHF-1; FGF12B

  • Species

    Canine

  • Source

    E. coli

  • Tag

    Tag Free

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    A0A5F4CAA4

  • Expression Region

    M1-T181

  • AA Sequence

    MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

  • Protein Length

    Full Length

  • Molecular Weight

    20 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Fibroblast growth factor 12 (FGF-12) is a member of the FGF family, which plays a crucial role in various biological processes, including cell proliferation, differentiation, and survival. Unlike other FGFs, FGF-12 does not exhibit classical growth factor functions, as it lacks the capability to bind to FGF receptors effectively. Instead, FGF-12 is predominantly expressed in the central nervous system and has been implicated in modulating neuronal excitability and synaptic transmission. Its unique properties suggest potential roles in neurodevelopmental disorders and neurodegenerative diseases. Research into recombinant FGF-12 proteins has gained traction due to their potential applications in understanding the underlying mechanisms of neurological functions and pathologies. Recombinant FGF-12 is utilized to investigate its interactions with intracellular signaling pathways and to explore its therapeutic potential in restoring normal neuronal function. Studies have shown that FGF-12 may influence the activity of ion channels, thereby affecting neuronal excitability and signaling. Furthermore, understanding the structural characteristics of FGF-12 through recombinant technology can provide insights into the functional diversity of FGFs in the nervous system. As researchers delve deeper into the functional aspects of FGF-12, it may pave the way for novel therapeutic strategies targeting various neurological conditions, emphasizing the importance of this protein in the field of neurobiology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US