Analytical Data
-
Gene name
FGF-12
- Application
-
Biological Activity
1. The ED50 is <20>5 × 104 units/mg. 2. Immobilized Human FGF-12 at 2.0 μg/ml (100 μl/well) can bind Human FGFR3-Fc. The ED50 of Human FGF-12 is 0.5-4.0 μg/ml. 3. Measured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells. The ED50 this effect is 9.139 ng/mL, corresponding to a specific activity is 1.094×10^5 U/mg. easured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells. The ED50 for this effect is 9.139 ng/mL, corresponding to a specific activity is 1.094×105 U/mg.
-
Alternative Names
rHuFGF-12; FHF1; FGF12B
-
Species
Human
-
Source
E. coli
-
Tag
Tag Free
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
P61328-1
-
Expression Region
E67-T243
-
AA Sequence
MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
-
Protein Length
Partial
-
Molecular Weight
21 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Fibroblast growth factor 12 (FGF-12) is a member of the FGF family, which plays a crucial role in various biological processes, including cell proliferation, differentiation, and survival. Unlike other FGFs, FGF-12 does not exhibit classical growth factor functions, as it lacks the capability to bind to FGF receptors effectively. Instead, FGF-12 is predominantly expressed in the central nervous system and has been implicated in modulating neuronal excitability and synaptic transmission. Its unique properties suggest potential roles in neurodevelopmental disorders and neurodegenerative diseases. Research into recombinant FGF-12 proteins has gained traction due to their potential applications in understanding the underlying mechanisms of neurological functions and pathologies. Recombinant FGF-12 is utilized to investigate its interactions with intracellular signaling pathways and to explore its therapeutic potential in restoring normal neuronal function. Studies have shown that FGF-12 may influence the activity of ion channels, thereby affecting neuronal excitability and signaling. Furthermore, understanding the structural characteristics of FGF-12 through recombinant technology can provide insights into the functional diversity of FGFs in the nervous system. As researchers delve deeper into the functional aspects of FGF-12, it may pave the way for novel therapeutic strategies targeting various neurological conditions, emphasizing the importance of this protein in the field of neurobiology.











