Analytical Data
-
Gene name
JAM-A/CD321
-
简介
The JAM-A/CD321 protein is critical for the formation of tight junctions in epithelial cells, participating in early junction development and recruiting PARD3. However, the formation of PARD6-PARD3 complex may hinder PARD3-JAM1 interaction, thus preventing tight junction assembly. JAM-A/CD321 Protein, Rat (HEK293, His) is the recombinant rat-derived JAM-A/CD321 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured by the ability of the immobilized protein to inhibit the adhesion of Vitronectin on HUVEC cells. The ED50 for this effect is 0.1574 μg/mL in the presence of 10 ng/mL Vitronectin. Corresponding to a specific activity is 6353.24 U/mg. Measured by the ability of the immobilized protein to inhibit the adhesion of Vitronectin on HUVEC cells. The ED50 for this effect is 0.1574 μg/mL in the presence of 10 ng/mL Vitronectin. Corresponding to a specific activity is 6353.24 U/mg.
-
Alternative Names
Junctional Adhesion Molecule A; JAM-A; JAM-1; PAM-1; CD321; F11R; JCAM
-
Species
Rat
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q9JHY1
-
Expression Region
K27-G238
-
AA Sequence
KGSVYSPQTAVQVPENDSVKLPCIYSGFSSPRVEWKFVQGSTTALVCYNNQITVPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEDGGQNYGEVSIHLTVLVPPSKPTVSIPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGVPMLTADAKKTRAFINSSYTIDPKSGDLVFDPVSAFDSGEYYCEAQNGYGTAMRSEAVRMEAVELNVGG
-
Protein Length
Extracellular Domain
-
Molecular Weight
25&28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
JAM-A (Junctional Adhesion Molecule A), also known as CD321, is a cell adhesion molecule predominantly expressed in endothelial cells and immune cells. It plays a crucial role in maintaining the integrity of tight junctions in epithelial and endothelial barriers, regulating leukocyte transmigration, and contributing to various physiological and pathological processes, including inflammation, tumor metastasis, and tissue regeneration. The research surrounding JAM-A/CD321 has gained increasing interest due to its involvement in various diseases, such as cancer, autoimmune disorders, and cardiovascular diseases, where it can influence cell signaling and adhesion mechanisms. Additionally, the functional diversity of JAM-A is highlighted by its interactions with multiple binding partners, including integrins and other adhesion molecules, which modulate cell behavior and fate. The development of recombinant JAM-A proteins facilitates detailed studies of its structure-function relationship, underlying molecular mechanisms, and potential therapeutic applications. Understanding the biological roles of JAM-A/CD321 through recombinant protein studies may offer insights into novel therapeutic strategies targeting inflammatory and metastatic pathways, highlighting its significance in biomedical research and potential clinical interventions.











