Analytical Data
-
Gene name
SINHCAF
-
简介
SINHCAF is a key subunit of the Sin3 deacetylase complex (Sin3/HDAC) and is essential for inhibiting genes related to the TGF-β signaling pathway. In embryonic stem (ES) cells, SINHCAF forms the SIN3A complex together with SIN3A, HDAC1, SAP30, RBBP4, OGT, and TET1. SINHCAF Protein, Human (GST) is the recombinant human-derived SINHCAF protein, expressed by E. coli , with N-GST labeled tag.
- Application
-
Alternative Names
Protein FAM60A; Tera protein homolog; C12orf14; FAM60A
-
Species
Human
-
Source
E. coli
-
Tag
N-GST
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NP50-1
-
Expression Region
M1-W221
-
AA Sequence
MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW
-
Protein Length
Full Length of Isoform-1
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SINHCAF, a protein known for its role in the regulation of synaptic plasticity, has garnered significant attention in the field of neuroscience and molecular biology. This protein is part of a complex signaling cascade that influences neuronal development and function, making it a crucial element in understanding mechanisms underlying learning and memory. Recent studies have shown that SINHCAF not only participates in synaptic transmission but also modulates transcriptional responses to synaptic activity, highlighting its multifaceted role in cellular communication. Researchers have been particularly interested in its implications for neurodegenerative diseases, as aberrations in SINHCAF function may contribute to cognitive decline. Advances in structural biology and molecular techniques have paved the way for the reconstitution of SINHCAF in vitro, allowing for detailed investigations into its interactions with other synaptic proteins. Understanding the functional dynamics of SINHCAF can provide insights into potential therapeutic targets for enhancing synaptic function and offering new avenues for treatment in neurological disorders. The significance of SINHCAF research lies in its potential to unravel intricate pathways involved in neurotransmission and to develop strategies aimed at restoring cognitive function in affected individuals.











