Analytical Data
-
Gene name
YTFE
-
简介
YTFE protein is a diiron-containing molecule that is crucially involved in the repair of iron-sulfur clusters under oxidative and nitrosative stress conditions. As a homodimer, YTFE plays a key role in mitigating damage to iron-sulfur clusters, a process necessary to maintain the integrity and function of various proteins within cells. YTFE Protein, E.coli (GST) is the recombinant E. coli-derived YTFE protein, expressed by E. coli , with N-GST labeled tag.
- Application
-
Alternative Names
Iron-sulfur cluster repair protein YtfE; Regulator of cell morphogenesis and NO signaling; RCMNS
-
Species
E.coli
-
Source
E. coli
-
Tag
N-GST
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P69506
-
Expression Region
M1-E220
-
AA Sequence
MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAEQPIEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYLTMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTPPPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE
-
Protein Length
Full Length
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
YTFE (Y-box binding protein 1) is a transcription factor that plays a crucial role in various cellular processes, including cell proliferation, differentiation, and response to stress. Recent studies have indicated that YTFE is involved in the regulation of genes associated with cancer progression and other diseases, making it a significant target for therapeutic interventions. The investigation into recombinant YTFE proteins has gained momentum as researchers aim to elucidate the protein’s functional mechanisms, interactions, and effects on cellular pathways.
The importance of producing recombinant YTFE lies in its potential applications in drug discovery and development. By generating YTFE proteins in heterologous systems, scientists can obtain sufficient quantities of the protein to study its structure and function, perform binding assays, and explore its role in oncogenesis. The characterization of YTFE’s interaction with other biomolecules, such as nucleic acids and proteins, is fundamental for understanding its regulatory mechanisms and pathways in cancer and other diseases.
Moreover, the recombinant production of YTFE allows for the exploration of post-translational modifications that affect its activity and stability. This research may reveal novel molecular targets for therapeutic strategies, thereby contributing to the design of effective treatments for conditions influenced by dysregulated YTFE activity. The overarching goal of this research is to provide insights into the functional roles of YTFE within cellular contexts and its implications in human health, offering pathways to innovative clinical applications.
