Analytical Data
-
Gene name
CD66e/CEACAM5
-
简介
CEACAM5 protein is a cell surface glycoprotein that cooperates with carcinoembryonic antigen-related molecules (such as CEACAM6) to participate in cell adhesion, intracellular signaling, and tumor progression. CEACAM5 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM5 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Biological Activity
1. Measured by its binding ability in a functional ELISA. Immobilized Galectin-4 protein (HY-P72638) at 2 μg/mL (100 μL/well) can bind CEACAM5. The Kd for this effect is 3.123 nM. 2. Loaded Precemtabart (HY-P990940) on AHC2 biosensor, can bind CEACAM5 Protein, Human (HEK293, His) with an affinity constant of 3.214E-09 M as determined in BLI assay. 3. Loaded Atrosimab (HY-P991049) on ProA biosensor, can bind TNFR-1/CD120a Protein, Human (HEK293, His) with an affinity constant of 2.076E-09 M as determined in BLI assay. Measured by its binding ability in a functional ELISA. Immobilized Galectin-4 protein (HY-P72638) at 2 μg/mL (100 μL/well) can bind CEACAM5. The Kd for this effect is 3.123 nM. Loaded Precemtabart (HY-P990940) on AHC2 biosensor, can bind CEACAM5 Protein, Human (HEK293, His) with an affinity constant of 3.214E-09 M as determined in BLI assay. Loaded Atrosimab (HY-P991049) on ProA biosensor, can bind TNFR-1/CD120a Protein, Human (HEK293, His) with an affinity constant of 2.076E-09 M as determined in BLI assay.
-
Alternative Names
Carcinoembryonic antigen-related cell adhesion molecule 5; Carcinoembryonic antigen; CEA; Meconium antigen 100; CD66e; CEACAM5
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P06731-1
-
Expression Region
K35-A685
-
AA Sequence
KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Molecular Weight
95-150 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD66e, also known as CEACAM5 or Carcinoembryonic Antigen (CEA), is a member of the carcinoembryonic antigen (CEA) family of glycoproteins, which are primarily expressed in epithelial tissues and play a crucial role in cell adhesion and signaling. The significance of CD66e in cancer biology, particularly in colorectal and other gastrointestinal cancers, has made it a focal point of research due to its overexpression in various malignancies. Its involvement in tumor progression, metastasis, and immune evasion highlights the potential of CD66e as a therapeutic target and a biomarker for cancer diagnosis and monitoring. The development of recombinant CD66e proteins allows for detailed studies on its biological functions and interactions, paving the way for innovative therapeutic approaches, including monoclonal antibody development and targeted drug delivery systems. Additionally, understanding the structural and functional characteristics of CD66e through recombinant expression enhances the knowledge of its role in tumor biology, potentially leading to novel diagnostic and treatment strategies for patients with CD66e-expressing tumors. The exploration of CD66e/CEACAM5 in the context of immunotherapy and its ability to modulate immune responses further underscores the relevance of this protein in contemporary cancer research. Overall, the study of CD66e/CEACAM5 recombinant proteins holds promise not only for advancing our understanding of cancer mechanisms but also for improving clinical outcomes through targeted therapeutic interventions.











