Cat: IPD-X35048

Recombinant Human CD66e/CEACAM5 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD66e/CEACAM5

  • 简介

    CEACAM5 protein is a cell surface glycoprotein that cooperates with carcinoembryonic antigen-related molecules (such as CEACAM6) to participate in cell adhesion, intracellular signaling, and tumor progression. CEACAM5 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM5 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    1. Measured by its binding ability in a functional ELISA. Immobilized Galectin-4 protein (HY-P72638) at 2 μg/mL (100 μL/well) can bind CEACAM5. The Kd for this effect is 3.123 nM. 2. Loaded Precemtabart (HY-P990940) on AHC2 biosensor, can bind CEACAM5 Protein, Human (HEK293, His) with an affinity constant of 3.214E-09 M as determined in BLI assay. 3. Loaded Atrosimab (HY-P991049) on ProA biosensor, can bind TNFR-1/CD120a Protein, Human (HEK293, His) with an affinity constant of 2.076E-09 M as determined in BLI assay. Measured by its binding ability in a functional ELISA. Immobilized Galectin-4 protein (HY-P72638) at 2 μg/mL (100 μL/well) can bind CEACAM5. The Kd for this effect is 3.123 nM. Loaded Precemtabart (HY-P990940) on AHC2 biosensor, can bind CEACAM5 Protein, Human (HEK293, His) with an affinity constant of 3.214E-09 M as determined in BLI assay. Loaded Atrosimab (HY-P991049) on ProA biosensor, can bind TNFR-1/CD120a Protein, Human (HEK293, His) with an affinity constant of 2.076E-09 M as determined in BLI assay.

  • Alternative Names

    Carcinoembryonic antigen-related cell adhesion molecule 5; Carcinoembryonic antigen; CEA; Meconium antigen 100; CD66e; CEACAM5

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P06731-1

  • Expression Region

    K35-A685

  • AA Sequence

    KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA

  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Molecular Weight

    95-150 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD66e, also known as CEACAM5 or Carcinoembryonic Antigen (CEA), is a member of the carcinoembryonic antigen (CEA) family of glycoproteins, which are primarily expressed in epithelial tissues and play a crucial role in cell adhesion and signaling. The significance of CD66e in cancer biology, particularly in colorectal and other gastrointestinal cancers, has made it a focal point of research due to its overexpression in various malignancies. Its involvement in tumor progression, metastasis, and immune evasion highlights the potential of CD66e as a therapeutic target and a biomarker for cancer diagnosis and monitoring. The development of recombinant CD66e proteins allows for detailed studies on its biological functions and interactions, paving the way for innovative therapeutic approaches, including monoclonal antibody development and targeted drug delivery systems. Additionally, understanding the structural and functional characteristics of CD66e through recombinant expression enhances the knowledge of its role in tumor biology, potentially leading to novel diagnostic and treatment strategies for patients with CD66e-expressing tumors. The exploration of CD66e/CEACAM5 in the context of immunotherapy and its ability to modulate immune responses further underscores the relevance of this protein in contemporary cancer research. Overall, the study of CD66e/CEACAM5 recombinant proteins holds promise not only for advancing our understanding of cancer mechanisms but also for improving clinical outcomes through targeted therapeutic interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US