Analytical Data
-
Gene name
ITM2B
-
简介
The ITM2B protein regulates amyloid beta A4 precursor protein (APP) processing by inhibiting amyloid beta peptide aggregation and fibril deposition. In addition to its effects on the amyloid-β pathway, ITM2B also contributes to neurite outgrowth, affecting neurobiological processes. ITM2B Protein, Human (HEK293, His) is the recombinant human-derived ITM2B protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
Integral Membrane Protein 2B; Immature BRI2; imBRI2; Protein E25B; Transmembrane Protein BRI; Bri; ITM2B; BRI; BRI2
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y287
-
Expression Region
Y76-S266
-
AA Sequence
YKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS
-
Protein Length
Lumenal Domain
-
Molecular Weight
29-33 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ITM2B (Integral Membrane Protein 2B) is a member of the ITM2 family, known for its role in mediating various cellular processes, including signaling and protein-protein interactions. Its implications in neurodegenerative diseases, particularly Alzheimer's disease, have garnered significant research interest. Advances in our understanding of ITM2B's functions suggest that it may influence amyloid beta processing and synaptic integrity, thus contributing to cognitive decline. Furthermore, its potential as a therapeutic target has prompted studies focusing on the structural and functional characterization of ITM2B, particularly in relation to its membrane topology and interactions with other proteins. These investigations aim to elucidate the mechanisms by which ITM2B might modulate neuronal health and disease, providing insights into its role in pathophysiological conditions and the development of novel treatment strategies. Given the growing prevalence of neurodegenerative disorders, understanding the molecular intricacies of ITM2B and its associated pathways is crucial for identifying targeted interventions that can mitigate disease progression and improve patient outcomes.
