Analytical Data
-
Gene name
Notum
-
简介
Notum Protein serves as a crucial negative regulator of the Wnt signaling pathway, playing a specific role in mediating the depalmitoleoylation of WNT proteins. The process of serine palmitoleoylation of WNT proteins is essential for their efficient binding to frizzled receptors, and Notum's carboxylesterase activity is instrumental in modulating this aspect of the Wnt signaling cascade. Notum Protein, Human (C330S, CHO, His) is the recombinant human-derived Notum protein, expressed by CHO , with C-His labeled tag.
- Application
-
Alternative Names
Palmitoleoyl-protein carboxylesterase NOTUM; NOTUM; hNOTUM
-
Species
Human
-
Source
CHO
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q6P988
-
Expression Region
S81-T451, C330S
-
AA Sequence
SAQQLNEDLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGGWYCFNRENCDSRYDTMRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFIPYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQYRHTDCVDTITCAPTEAIRRGIRYWNGVVPERCRRQFQEGEEWNCFFGYKVYPTLRSPVFVVQWLFDEAQLTVDNVHLTGQPVQEGLRLYIQNLGRELRHTLKDVPASFAPACLSHEIIIRSHWTDVQVKGTSLPRALHCWDRSLHDSHKASKTPLKGCPVHLVDSCPWPHCNPSCPT
-
Protein Length
Partial
-
Molecular Weight
36-45 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Notum is a secreted protein belonging to the retinol dehydrogenase family, playing a crucial role in modulating Wnt signaling pathways. It acts by removing palmitoleic acid from Wnt proteins, thus inhibiting Wnt signaling, which is vital for various cellular processes including cell differentiation, proliferation, and embryonic development. Dysregulation of Wnt signaling due to altered Notum levels has been implicated in various diseases, including cancers and neurodegenerative disorders. Recent studies have focused on characterizing the biochemical properties of Notum and understanding its enzymatic mechanisms. Researchers are also exploring its potential as a therapeutic target, given its significant role in developmental biology and disease pathology. Additionally, recombinant Notum proteins have been produced for in vitro studies, allowing for detailed analysis of its function and interactions within the Wnt signaling framework. This research holds promise for developing innovative treatments aimed at modulating Wnt signaling in disease contexts.
