Analytical Data
-
Gene name
CIB2
-
简介
CIB2 protein: Calcium and integrin-binding protein involved in intracellular calcium regulation, auditory hair cell mechanotransduction, and maintenance of stereocilia bundle morphology. CIB2 Protein, Human (N-His) is the recombinant human-derived CIB2, expressed by E. coli, with N-6*His labeled tag. The total length of CIB2 Protein, Human (N-His) is 187 a.a..
- Application
-
Alternative Names
Calcium and integrin-binding family member 2; Kinase-interacting protein 2; KIP2
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
O75838-1
-
Expression Region
M1-I187
-
AA Sequence
MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDLELTLARLTKSELDEEEVVLVCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRI
-
Protein Length
Full Length of Isoform-1
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CIB2 (Calcium and Integrin Binding Protein 2) is an important calcium-binding protein that plays a critical role in various cellular processes, including cell adhesion, migration, and signaling pathways. The study of CIB2 has gained attention due to its involvement in several physiological and pathological conditions, including cardiac function and neurological disorders. Low CIB2 expression has been associated with heart diseases, while its dysregulation may influence neuronal survival and development. Furthermore, CIB2 interacts with integrins, which are essential for cell adhesion and communication with the extracellular matrix, highlighting its significance in mechanical signaling and cellular responses to external stimuli. Research into recombinant CIB2 aims to elucidate its structural properties and functional mechanisms, which can lead to potential therapeutic applications. By producing recombinant CIB2 in heterologous systems, scientists can study its interactions at a molecular level and investigate its role in cellular functions. This work is essential for understanding how CIB2 contributes to cellular health and disease, paving the way for novel interventions in related medical conditions. Overall, the study of CIB2 not only enhances our understanding of fundamental biological processes but also contributes to the development of targeted therapies that could ameliorate diseases associated with its dysfunction.
