Cat: IPD-X26911

Recombinant Human AHR Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AHR

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Aryl hydrocarbon receptor; Ah receptor; lass E basic helix-loop-helix protein 76 (bHLHe76); AHR; BHLHE76

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-10*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P35869

  • Expression Region

    F220-F420

  • AA Sequence

    FICRLRCLLDNSSGFLAMNFQGKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGCDAKGRIVLGYTEAELCTRGSGYQFIHAADMLYCAESHIRMIKTGESGMIVFRLLTKNNRWTWVQSNARLLYKNGRPDYIIVTQRPLTDEEGTEHLRKRNTKLPFMFTTGEAVLYEATNPF

  • Protein Length

    Partial

  • Molecular Weight

    30 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of AHR (Aryl Hydrocarbon Receptor) recombinant proteins has gained significant attention due to the crucial role AHR plays in various biological processes, including xenobiotic metabolism, immune regulation, and cell differentiation. AHR, a ligand-activated transcription factor, is primarily known for its role in mediating the effects of environmental pollutants, such as dioxins and polycyclic aromatic hydrocarbons. These compounds can bind to AHR, leading to alterations in gene expression that can affect cellular function and contribute to toxicological outcomes. As researchers have increasingly focused on the implications of AHR activation in both developmental biology and the pathogenesis of diseases, including cancer and autoimmune disorders, the need for precise and functional AHR recombinant proteins has become apparent. The recombinant proteins facilitate the study of AHR's molecular mechanisms and its interactions with various ligands, while also providing insight into potential therapeutic strategies targeting AHR pathways. Furthermore, the development of AHR recombinant proteins is essential for high-throughput screening assays aimed at identifying novel AHR modulators in drug discovery. Overall, the investigation of AHR recombinant proteins is a promising area of research that holds the potential to unravel complex biological processes and address public health concerns related to environmental exposures.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US