Analytical Data
-
Gene name
SLC25A4
- Application
-
Alternative Names
ADP,ATP carrier protein 1; ADP,ATP carrier protein, heart/skeletal muscle isoform T1; Adenine nucleotide translocator 1; Solute carrier family 25 member 4
-
Species
Human
-
Source
E. coli Cell-free
-
Tag
N-10*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P12235
-
Expression Region
G2-V298
-
AA Sequence
GDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
30-38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC25A4, also known as the adenine nucleotide translocator 1 (ANT1), is a pivotal protein encoded by the SLC25A4 gene, primarily located in the inner mitochondrial membrane. It plays a critical role in the transport of adenine nucleotides across the mitochondrial membrane, facilitating ATP/ADP exchange essential for cellular energy metabolism. Mutations or dysfunctions in SLC25A4 have been implicated in various mitochondrial disorders, leading to significant clinical manifestations such as exercise intolerance, cardiomyopathy, and neurodegeneration. Given its fundamental role in cellular energy homeostasis, SLC25A4 is a focal point for research aimed at understanding mitochondrial pathologies and developing potential therapeutic strategies. The study of recombinant SLC25A4 protein enables detailed characterization of its transport mechanisms, interaction with other mitochondrial proteins, and the impact of specific mutations on its function. By utilizing recombinant protein technology, researchers can produce large quantities of SLC25A4 for biochemical assays, structural analysis, and drug screening, enhancing our understanding of its physiological roles and the pathophysiological consequences of its dysfunction. Furthermore, insights gained from SLC25A4 research may pave the way for novel interventions targeting mitochondrial-related diseases, highlighting the necessity of continued exploration into the complex dynamics of this important transporter protein.
