Analytical Data
-
Gene name
RNF182
- Application
-
Alternative Names
E3 ubiquitin-protein ligase RNF182; RNF182; RING finger protein 182; RING-type E3 ubiquitin transferase RNF182
-
Species
Human
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N6D2
-
Expression Region
M1-R183
-
AA Sequence
MASQPPEDTAESQASDELECKICYNRYNLKQRKPKVLECCHRVCAKCLYKIIDFGDSPQGVIVCPFCRFETCLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVSPSHTSSNCLVITIMEVQRESSPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIR
-
Protein Length
Partial
-
Molecular Weight
28-33 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RNF182, a member of the RING finger protein family, has garnered interest in recent years due to its potential roles in various cellular processes, including cell proliferation, apoptosis, and DNA damage response. As a ubiquitin E3 ligase, RNF182 is involved in the ubiquitination pathway, which is crucial for protein degradation and regulation within the cell. Dysregulation of ubiquitination processes is often linked to various diseases, including cancer. Research has shown that RNF182 interacts with several key proteins involved in signaling pathways that govern these cellular processes, suggesting its significance in maintaining cellular homeostasis. Furthermore, studies indicate that RNF182 may have implications in the modulation of immune responses and has been associated with the regulation of transcription factors. Despite its emerging importance, the detailed functional mechanisms of RNF182 and its full spectrum of biological roles remain to be elucidated. Investigating recombinant RNF182 proteins can help in deciphering its specific functions, interactions, and potential therapeutic targetability in diseases such as cancer, making it a valuable focus for ongoing research in molecular biology and oncology.
