Cat: IPD-X26876

Recombinant Human CHRNA7 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CHRNA7

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Neuronal acetylcholine receptor subunit alpha-7; CHRNA7; NACHRA7

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P36544-1

  • Expression Region

    G23-T230

  • AA Sequence

    GEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRT

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    32 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The CHRNA7 gene encodes the alpha-7 nicotinic acetylcholine receptor (AChR), a pivotal protein involved in synaptic transmission and neuronal communication. This receptor is particularly significant in the central nervous system, where it contributes to cognitive functions and has been implicated in various neurological disorders, including schizophrenia, Alzheimer’s disease, and depression. Research has shown that the alpha-7 AChR plays a crucial role in modulating the release of neurotransmitters such as dopamine and glutamate, making it a promising target for therapeutic interventions. The creation of recombinant CHRNA7 proteins allows for detailed studies of the receptor's structure, function, and interactions with ligands and pharmaceuticals. By expressing and purifying the CHRNA7 receptor in heterologous systems, researchers can investigate its pharmacological properties and potential as a drug target. Additionally, studying the receptor's behavior in different cellular environments can provide insights into its role in disease mechanisms. Understanding how the CHRNA7 receptor operates at a molecular level is essential for developing novel treatments for neuropsychiatric conditions, making it an important focus of ongoing research in neuroscience and drug development.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US