Analytical Data
-
Gene name
CHRNA7
- Application
-
Alternative Names
Neuronal acetylcholine receptor subunit alpha-7; CHRNA7; NACHRA7
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P36544-1
-
Expression Region
G23-T230
-
AA Sequence
GEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRT
-
Protein Length
Extracellular Domain
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The CHRNA7 gene encodes the alpha-7 nicotinic acetylcholine receptor (AChR), a pivotal protein involved in synaptic transmission and neuronal communication. This receptor is particularly significant in the central nervous system, where it contributes to cognitive functions and has been implicated in various neurological disorders, including schizophrenia, Alzheimer’s disease, and depression. Research has shown that the alpha-7 AChR plays a crucial role in modulating the release of neurotransmitters such as dopamine and glutamate, making it a promising target for therapeutic interventions. The creation of recombinant CHRNA7 proteins allows for detailed studies of the receptor's structure, function, and interactions with ligands and pharmaceuticals. By expressing and purifying the CHRNA7 receptor in heterologous systems, researchers can investigate its pharmacological properties and potential as a drug target. Additionally, studying the receptor's behavior in different cellular environments can provide insights into its role in disease mechanisms. Understanding how the CHRNA7 receptor operates at a molecular level is essential for developing novel treatments for neuropsychiatric conditions, making it an important focus of ongoing research in neuroscience and drug development.
