Analytical Data
-
Gene name
ECM1
- Application
-
Alternative Names
Extracellular matrix protein 1; Secretory component p85
-
Species
Human
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16610-1
-
Expression Region
M1-E540
-
AA Sequence
MGTTARAALVLTYLAVASAASEGGFTATGQRQLRPEHFQEVGYAAPPSPPLSRSLPMDHPDSSQHGPPFEGQSQVQPPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQEAVPLQKELPSLQHPNEQKEGTPAPFGDQSHPEPESWNAAQHCQQDRSQGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSHLTRQGETLNFLEIGYSRCCHCRSHTNRLECAKLVWEEAMSRFCEAEFSVKTRPHWCCTRQGEARFSCFQEEAPQPHYQLRACPSHQPDISSGLELPFPPGVPTLDNIKNICHLRRFRSVPRNLPATDPLQRELLALIQLEREFQRCCRQGNNHTCTWKAWEDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPNLMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLSPGDEQVNCFNINYLRNVALVSGDTENAKGQGEQGSTGGTNISSTSEPKEE
-
Protein Length
Full Length of Isoform-1
-
Molecular Weight
Predicted band size: 60.2 kDa; Observed band size: 80-90 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ECM1 (Extracellular Matrix Protein 1) is a glycoprotein that plays a significant role in the composition and organization of the extracellular matrix (ECM), which is crucial for tissue development, maintenance, and repair. Research into ECM1 has expanded due to its involvement in various physiological and pathological processes, including fibrosis, tumor progression, and wound healing. ECM1 has been shown to interact with multiple ECM components, influencing cell adhesion, migration, and differentiation. Moreover, alterations in ECM1 expression have been implicated in several diseases, particularly in cancer where it may contribute to a tumor-promoting microenvironment. Given its potential as a biomarker and therapeutic target, there is ongoing interest in characterizing recombinant ECM1 proteins. These recombinant forms allow for detailed investigations into the structure-function relationships of ECM1, helping to elucidate its mechanisms of action in both normal physiological contexts and disease states. The recombinant proteins can also facilitate studies on their interactions with other ECM components, cell receptors, and signaling pathways, providing insights that may lead to novel strategies for disease intervention and tissue engineering applications. Overall, the research on ECM1 and its recombinant proteins is vital for advancing our understanding of ECM dynamics and their implications in health and disease.
