Recombinant Human Mer Protein (HEK293)，His

Mer

MER tyrosine kinase (MERTK) is a transmembrane protein with transmembrane receptor protein tyrosine kinase activity. MERTK has oncogenic properties and is often overexpressed or activated in various malignancies, activating several downstream signaling pathways including MAPK/ERK, PI3K/AKT, and JAK/STAT. MERTK is involved in animal organ development, synapse elimination, neutrophil clearance and protein kinase B signaling. Mer Protein, Human (HEK293, His) is the recombinant human-derived Mer protein, expressed by HEK293 , with C-6*His labeled tag.

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

Measured by its binding ability in a functional ELISA.When Recombinant Mer Protein is immobilized at 2 µg/mL (100 µL/well) can bind Biotinylated Recombinant Human GAS6. The ED50 for this effect is 3.154 μg/mL. Measured by its binding ability in a functional ELISA.When Recombinant Mer Protein is immobilized at 2 µg/mL (100 µL/well) can bind Biotinylated Recombinant Human GAS6. The ED50 for this effect is 3.154 μg/mL.

Tyrosine-protein kinase Mer/Proto-oncogene c-Mer/Receptor tyrosine kinase MerTK/MERTK/MER

Human

HEK293

C-6*His

Greater than 90% as determined by SDS-PAGE.

Q1RMG3

M1-A323

MKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEQPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVSKGVQINIKAIPSPPTEVSIRNSTAHSILISWVPGFDGYSPFRNCSIQVKEADPLSNGSVMIFNTSALPHLYQIKQLQALANYSIGVSCMNEIGWSAVSPWILASTTEGAPSVAPLNVTVFLNESSDNVDIRWMKPPTKQQDGELVGYRISHVWQSAGISKELLEEVGQNGSRARISVQVHNATCTVRIAAVTKGGVGPFSDPVKIFIPAHGWVDYAPSSTPAPGNA

Partial

60-120 kDa

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.