Analytical Data
-
Gene name
Calcium-sensing R/CaSR
-
简介
Calcium-sensing receptor (CaSR) is a G-protein-coupled receptor that is essential for maintaining calcium homeostasis. It senses changes in extracellular calcium concentration, regulates parathyroid hormone (PTH) production, and activates the phosphatidylinositol-calcium second messenger system. Calcium-sensing R/CaSR Protein, Human (HEK293, His) is the recombinant human-derived Calcium-sensing R/CaSR protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Biological Activity
Measured by its ability to inhibit the proliferation of HT-29 cells. The ED50 for this effect is 38.93 ng/mL, corresponding to a specific activity is 25687.131 U/mg. Measured by its ability to inhibit the proliferation of HT-29 cells. The ED50 for this effect is 38.93 ng/mL, corresponding to a specific activity is 25687.131 U/mg.
-
Alternative Names
Extracellular calcium-sensing receptor; CASR; CaR; hCasR; Parathyroid cell calcium-sensing receptor 1; PCaR1; Calcium-sensing Receptor
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P41180-1
-
Expression Region
Y20-K601
-
AA Sequence
YGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKIDSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQFKSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKEFWEETFNCHLQEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRPLCTGDENISSVETPYIDYTHLRISYNVYLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFDECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFSNCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACNKCPDDFWSNENHTSCIAK
-
Protein Length
Partial
-
Molecular Weight
95-130 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Calcium-sensing receptor (CaSR) is a G-protein coupled receptor that plays a critical role in maintaining calcium homeostasis in the body by sensing extracellular calcium levels. Dysregulation of CaSR has been implicated in various pathological conditions, including hyperparathyroidism, osteoporosis, and certain cancers. The receptor is expressed in multiple tissues, including the parathyroid glands, kidneys, and bones, making it a key player in calcium and phosphate metabolism, as well as in the regulation of other physiological processes such as hormone secretion. Recent advancements in molecular biology and structural analysis have enabled the production of recombinant CaSR proteins, facilitating studies on its structure-function relationships, ligand binding properties, and downstream signaling pathways. This research is crucial for developing novel therapeutics targeting CaSR, which may offer innovative approaches for treating calcium-related disorders. The increasing understanding of CaSR's role in health and disease highlights its potential as a therapeutic target, making the study of its recombinant forms essential for future medical applications.
