Analytical Data
-
Gene name
BPIFA2
-
简介
The BPIFA2 protein, also known as bactericidal/permeability-increasing fold family A member 2, has significant antibacterial activity, particularly against Pseudomonas aeruginosa. The protein is effective against bacterial infections caused by Pseudomonas aeruginosa, a pathogen known to be resistant to many antibiotics. BPIFA2 Protein, Human (HEK293, His) is the recombinant human-derived BPIFA2 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
BPI fold-containing family A member 2; PSP; C20orf70; SPLUNC2
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96DR5
-
Expression Region
E19-I249
-
AA Sequence
ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BPIFA2, or Bactericidal Permeability-Increasing Factor A2, is a member of the lipocalin family that has garnered significant interest due to its potential roles in innate immunity and mucosal defense. Originally identified in the respiratory tract, BPIFA2 is secreted by epithelial cells and is believed to contribute to host defense mechanisms against respiratory pathogens. Research has indicated that BPIFA2 exhibits antimicrobial properties, which may play a crucial role in protecting the lungs from infections, particularly in conditions such as chronic obstructive pulmonary disease (COPD) and asthma. Furthermore, BPIFA2 has been implicated in modulating inflammation and can influence mucosal barrier function. Studies have focused on understanding the structural characteristics of BPIFA2, revealing its ability to bind small molecules and proteins, suggesting its role in biological processes beyond antimicrobial activity. The recombinant production of BPIFA2 enables detailed investigations into its functional properties, interactions, and therapeutic potential. As researchers explore the role of BPIFA2 in various disease contexts, including its potential as a biomarker or therapeutic target, the recombinant protein serves as a vital tool for advancing our understanding of mucosal immunity and developing novel strategies for treating respiratory diseases.











