Analytical Data
-
Gene name
TLE3
-
简介
The TLE3 protein is a transcriptional corepressor that inhibits Wnt signaling by binding to transcription factors such as CTNNB1 and TCF family members. It forms homotetramers, hetero-oligomers, and interacts with AES.TLE3 Protein, Human (His) is the recombinant human-derived TLE3 protein, expressed by E. coli , with N-GST labeled tag.
- Application
-
Alternative Names
Transducin-like enhancer protein 3; ESG3; TLE3; KIAA1547
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His;N-GST
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q04726
-
Expression Region
S484-Y772
-
AA Sequence
SHGEVVCAVTISNPTRHVYTGGKGCVKIWDISQPGSKSPISQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY
-
Protein Length
Partial
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TLE3 (Transducin-Like Enhancer of Split 3) is a member of the TLE protein family, which are known to act as corepressors in various signaling pathways, particularly in the context of transcriptional regulation during development and differentiation. The importance of TLE3 has been underscored by its roles in multiple biological processes, including development of the nervous system, regulation of stem cell fate, and modulation of immune responses. Given its involvement in critical signaling pathways such as Notch and Wnt, aberrations in TLE3 expression or function have been implicated in various diseases, particularly cancer. Research into the recombinant expression of TLE3 has become crucial for elucidating its molecular mechanisms and potential therapeutic applications. By producing TLE3 as a recombinant protein, scientists can investigate its interactions with other proteins, post-translational modifications, and its functional domains. This recombinant protein also serves as a valuable tool in high-throughput screening assays, facilitating the identification of small molecules that may modulate TLE3 activity and offer insights into its contribution to oncogenesis. Overall, the study of TLE3 recombinant protein holds promise for advancing our understanding of its biological roles and therapeutic potential in tackling diseases linked to its dysregulation.











