Analytical Data
-
Gene name
HER2/CD340
-
简介
The HER2/CD340 protein is a key protein tyrosine kinase that is a component of multiple cell surface receptor complexes and requires coreceptors for ligand binding.Its interaction within the neuregulin-receptor complex depends on neuregulin, and GP30 emerges as a potential ligand.HER2/CD340 Protein, Rat (His) is the recombinant rat-derived HER2/CD340 protein, expressed by E.coli , with C-6*His labeled tag.
- Application
-
Alternative Names
Receptor tyrosine-protein kinase erbB-2; p185neu; CD340; Erbb2; Neu
-
Species
Rat
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P06494
-
Expression Region
A67-V323
-
AA Sequence
ANASLSFLQDIQEVQGYMLIAHNQVKRVPLQRLRIVRGTQLFEDKYALAVLDNRDPQDNVAASTPGRTPEGLRELQLRSLTEILKGGVLIRGNPQLCYQDMVLWKDVFRKNNQLAPVDIDTNRSRACPPCAPACKDNHCWGESPEDCQILTGTICTSGCARCKGRLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMHNPEGRYTFGASCVTTCPYNYLSTEVGSCTLVCPPNNQEV
-
Protein Length
Partial
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HER2, also known as ERBB2 or CD340, is a member of the human epidermal growth factor receptor (EGFR) family and plays a crucial role in cell signaling for growth and differentiation. Overexpression of HER2 is associated with aggressive forms of breast cancer and other malignancies, making it an important therapeutic target. Research has demonstrated that HER2 promotes oncogenesis through pathways that lead to increased cell proliferation and survival. Recombinant HER2 proteins have gained attention in the scientific community for their potential applications in diagnostics and therapeutics, including monoclonal antibody development and targeted therapies like trastuzumab, which has improved patient outcomes significantly. The ability to produce recombinant HER2 enables detailed studies of its structure, function, and interactions with potential inhibitory agents. Moreover, this research facilitates the development of novel strategies for cancer treatment, including the use of HER2 as a biomarker to guide therapy decisions. The ongoing exploration of HER2/CD340 recombinant proteins is vital not only for understanding its role in cancer biology but also for advancing personalized medicine approaches targeting HER2-positive tumors.











