Analytical Data
-
Gene name
TMEM25
-
简介
TMEM25 Protein, crucial in neurons, modulates the degradation of the NMDA receptor GRIN2B subunit, influencing the intricate regulation of neuronal excitability. Its interaction with GRIN2B highlights its role in dynamic processes central to neurotransmission and synaptic function. TMEM25 Protein, Human (HEK293, His) is the recombinant human-derived TMEM25 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
Transmembrane protein 25; TMEM25
-
Species
Human
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q86YD3-2
-
Expression Region
E27-P224
-
AA Sequence
ELEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQLQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANASVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAP
-
Protein Length
Partial
-
Molecular Weight
32-60 kDa due to glycosylation
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM25, or Transmembrane Protein 25, has garnered attention in recent years due to its potential roles in cellular signaling and regulation. Found in various tissues, TMEM25 is thought to be involved in pathways linked to cell proliferation and apoptosis, making it a candidate for studying various diseases, including cancers and metabolic disorders. Its specific functions remain largely unexplored, with prior research indicating its involvement in cellular responses to stress and the regulation of ion channels. Additionally, the expression patterns of TMEM25 have raised questions about its relevance in neurological conditions, suggesting a link between its activity and neuronal health. As a transmembrane protein, the study of TMEM25 through recombinant protein techniques is crucial for elucidating its structure and function. By producing TMEM25 recombinantly, researchers can investigate its interactions with other proteins, explore its structural properties, and assess its role in cellular mechanisms through various biochemical assays. This research may also pave the way for identifying potential therapeutic targets, particularly in diseases where TMEM25 is implicated. Overall, understanding TMEM25's biological significance through the study of its recombinant protein could provide valuable insights into its contributions to health and disease.
