Analytical Data
-
Gene name
TMEM156
-
简介
TMEM156 Protein is a member of transmembrane proteins (TMEM) family. The expression levels of TMEM156 correlates with patient survival. TMEM156 is upregulated in tumor tissue. Many genes positively correlated with TMEM156 are involved in multiple immunological processes. Furthermore, genes negatively correlated with TMEM156 are linked with RHO GTPase effectors, which results in a poorer response to receptor activation, thus reducing cancer cell proliferation, survival, and migration. TMEM156 Protein, Human (HEK293, His) is the recombinant human-derived TMEM156 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
Transmembrane protein 156; TMEM156
-
Species
Human
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
AAH30803.1
-
Expression Region
K26-S211
-
AA Sequence
KTPKERTLELSCLEVCLQSNFTYSLSSLNFSFVTFLQPVRETQIIMRIFLNPSNFRNFTRTCQDITGEFKMCSSCLVCEPKGNMDFISQEQTSKVLIRRGSMEVKANDFHSPCQHFNFSVAPLVDHLEEYNTTCHLKNHTGRSTIMEDEPSKEKSINYTCRIMEYPNDCIHISLHLEMDIKNITCS
-
Molecular Weight
35-55 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM156, or Transmembrane Protein 156, is a relatively less-studied protein that has recently garnered significant interest in the realm of cellular biology and medical research. Preliminary studies suggest that TMEM156 may play a crucial role in cellular processes such as membrane trafficking, signal transduction, and possibly in the development of certain diseases. The protein is ubiquitously expressed across different tissues, indicating its potential involvement in fundamental biological functions. Understanding the structure and function of TMEM156 is vital, as alterations in its expression or function may relate to various pathological conditions, including cancer and neurodegenerative diseases. Recent advancements in recombinant protein technology enable researchers to produce TMEM156 in a laboratory setting, facilitating detailed biochemical and biophysical analyses. By generating and characterizing recombinant TMEM156, scientists aim to elucidate its functional mechanisms, interactions with other proteins, and its role in cellular homeostasis. This research not only contributes to the basic understanding of TMEM156 but also paves the way for its potential application in therapeutic strategies, highlighting the necessity for further studies to unravel its significance in health and disease.
