Analytical Data
-
Gene name
DCBLD1
- Application
-
Alternative Names
Discoidin, CUB and LCCL domain-containing protein 1; DCBLD1
-
Species
Human
-
Source
HEK293
-
Tag
C-10*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q8N8Z6-2
-
Expression Region
E35-V459
-
AA Sequence
EELGDGCGHLVTYQDSGTMTSKNYPGTYPNHTVCEKTITVPKGKRLILRLGDLDIESQTCASDYLLFTSSSDQYGPYCGSMTVPKELLLNTSEVTVRFESGSHISGRGFLLTYASSDHPDLITCLERASHYLKTEYSKFCPAGCRDVAGDISGNMVDGYRDTSLLCKAAIHAGIIADELGGQISVLQRKGISRYEGILANGVLSRDGSLSDKRFLFTSNGCSRSLSFEPDGQIRASSSWQSVNESGDQVHWSPGQARLQDQGPSWASGDSSNNHKPREWLEIDLGEKKKITGIRTTGSTQSNFNFYVKSFVMNFKNNNSKWKTYKGIVNNEEKVFQGNSNFRDPVQNNFIPPIVARYVRVVPQTWHQRIALKVELIGCQITQGNDSLVWRKTSQSTSVSTKKEDETITRPIPSEETSTGINITTV
-
Protein Length
Extracellular Domain
-
Molecular Weight
55-75 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DCBLD1, or Drosophila Cbl-b-like domain protein 1, is a protein that has garnered attention due to its potential roles in various biological processes, including cellular signaling and development. Recent studies suggest that DCBLD1 may play a crucial role in modulating extracellular matrix interactions and influencing cell adhesion and migration. Its unique structural features, including specific protein domains, indicate that it may be involved in receptor tyrosine kinase signaling pathways, which are essential for normal cellular functions and developmental processes. Furthermore, dysregulation of DCBLD1 has been implicated in several diseases, including cancer and cardiovascular disorders, highlighting its significance in both health and disease. Investigating the mechanisms of DCBLD1's action could lead to a better understanding of these conditions and potentially reveal new therapeutic targets. As a recombinant protein, DCBLD1 can be produced in vitro for further studies, allowing researchers to elucidate its biological function and interactions in a controlled environment. Overall, the study of DCBLD1 is a promising field that holds the potential to uncover novel insights into cellular communication and disease mechanisms.
