Cat: IPD-X30366

Recombinant Human Kallikrein-3/PSA Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Kallikrein-3/PSA

  • 简介

    Kallikrein-3 (PSA) protein, pivotal in the male reproductive system, hydrolyzes semenogelin-1, a seminal vesicle protein. This enzymatic activity initiates seminal coagulum liquefaction, crucial for sperm mobility and fertility. PSA's cleavage of semenogelin-1 highlights its importance in the complex processes of semen physiology and male reproductive function. Kallikrein-3/PSA Protein, Human (237a.a, HEK293, His) is the recombinant human-derived Kallikrein-3/PSA protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Prostate-specific antigen; PSA; Gamma-seminoprotein; Kallikrein-3; P-30 antigen; Semenogelase; KLK3; APS

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P07288

  • Expression Region

    I25-P261

  • AA Sequence

    IVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    35.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Kallikrein-3, also known as Prostate-Specific Antigen (PSA), is a serine protease encoded by the KLK3 gene and primarily expressed in the prostate. Its discovery and subsequent role as a biomarker for prostate cancer diagnosis and monitoring have been pivotal in the field of urology. Elevated PSA levels in serum are often associated with prostate malignancies, leading to its use in screening and management protocols. However, PSA is not exclusively a cancer marker, as benign prostatic hyperplasia and prostatitis can also raise PSA levels, complicating its clinical utility. The recombinant production of Kallikrein-3 has enabled significant advancements in research and therapeutic applications. By generating large quantities of pure, functional PSA, scientists can conduct detailed studies on its biochemical properties, interactions with various molecules, and its role in prostate cancer progression. Furthermore, recombinant PSA is essential for developing more precise diagnostic tools and evaluating new therapeutic approaches, including anti-PSA antibodies and targeted therapies. As research continues, understanding the nuances of Kallikrein-3 will likely lead to enhanced strategies for early cancer detection, individualized treatment options, and improved patient outcomes in prostate cancer management. The ongoing exploration of Kallikrein-3's functions and mechanisms underscores the importance of this protein in both basic research and clinical applications in oncology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US