Analytical Data
-
Gene name
Carbonic Anhydrase 13
- Application
-
Alternative Names
rHuCarbonic Anhydrase 13, His; Carbonic Anhydrase 13; Carbonate Dehydratase XIII; Carbonic Anhydrase XIII; CA13
-
Species
Human
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N1Q1
-
Expression Region
M1-F261
-
AA Sequence
MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFHHHHHHH
-
Protein Length
Partial
-
Molecular Weight
32.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Carbonic Anhydrase 13 (CA13) is a member of the carbonic anhydrase family of enzymes, which play a crucial role in regulating pH and carbon dioxide levels in various biological systems. Identified primarily in the human central nervous system, CA13 is implicated in several physiological processes, including neural function and the regulation of acid-base balance. Recent studies have highlighted its potential involvement in pathological conditions such as cancer and neurological disorders, making it a target of interest for therapeutic interventions. The recombinant production of CA13 has garnered attention as it allows for the detailed study of its enzymatic properties, structural characteristics, and interaction with inhibitors or substrates. Furthermore, understanding CA13’s role could elucidate its contribution to disease mechanisms and pave the way for novel treatments. The development of efficient recombinant expression systems for CA13 will facilitate investigations into its functional significance and therapeutic potentials, thereby enhancing our comprehension of its biological roles and potential as a biomarker or therapeutic target.











