Cat: IPD-X33499

Recombinant Human PMM1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PMM1

  • 简介

    The PMM1 protein is key to the synthesis of GDP-mannose and polyethylene glycol-phosphate-mannose and is essential for the mannosyl transfer reaction. Its enzymatic activity contributes to the biosynthesis of mannose-containing glycoconjugates, which are critical for protein glycosylation and related cellular processes. PMM1 Protein, Human (His) is the recombinant human-derived PMM1 protein, expressed by E. coli , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Phosphomannomutase 1; PMM 1; PMMH-22; PMM1; PMMH22

  • Species

    Human

  • Source

    E. coli

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q92871

  • Expression Region

    M1-A262

  • AA Sequence

    MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQLGDGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFPETAHEA

  • Protein Length

    Full Length

  • Molecular Weight

    49 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PMM1 (phosphomannomutase 1) is an essential enzyme involved in the biosynthesis of glycoproteins and glycolipids, playing a critical role in the conversion of mannose-6-phosphate to mannose-1-phosphate, a crucial step in the carbohydrate metabolism pathway. Mutations in the PMM1 gene are associated with congenital disorders such as Congenital Disorders of Glycosylation (CDG), specifically CDG-Ib, which can lead to various clinical manifestations, including developmental delays, liver dysfunction, and immune deficiencies. Research involving the recombinant expression of PMM1 protein allows for the detailed study of its enzymatic properties, substrate specificity, and the impact of mutations on its function. By utilizing recombinant DNA techniques, scientists can produce large quantities of the PMM1 protein for biochemical assays, structural analysis, and potential therapeutic applications. Understanding the structure and function of PMM1 at a molecular level may provide insights into the mechanisms of glycosylation disorders and facilitate the development of novel treatments or gene therapies aimed at correcting metabolic defects. The investigation of PMM1 not only advances our knowledge of glycosylation pathways but also highlights the importance of proper protein function in human health, making it a significant target for biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US