Analytical Data
-
Gene name
Maleylacetoacetate isomerase/GSTZ1
-
简介
The maleylacetoacetate isomerase/GSTZ1 protein is a member of the GST superfamily and detoxifies electrophilic molecules. It converts maleylacetoacetate to fumarylacetoacetate, a key step in phenylalanine/tyrosine degradation. Maleylacetoacetate isomerase/GSTZ1 Protein, Human (N-His) is the recombinant human-derived Maleylacetoacetate isomerase/GSTZ1 protein, expressed by E. coli , with N-6*His labeled tag.
- Application
-
Alternative Names
rHuMaleylacetoacetate isomerase/GSTZ1, His; Maleylacetoacetate Isomerase; MAAI; GSTZ1-1; Glutathione S-Transferase Zeta 1; GSTZ1
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
NP_665877.1
-
Expression Region
Q2-A216
-
AA Sequence
QAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Maleylacetoacetate isomerase (MAAi) is an enzyme that plays a crucial role in the catabolic pathway of tyrosine, facilitating the conversion of maleylacetoacetate into fumarate and acetoacetate. Deficiencies in MAAi can lead to metabolic disorders such as hereditary tyrosinemia, a condition characterized by the accumulation of toxic intermediates that can cause severe liver and kidney damage. The enzyme is encoded by the GSTZ1 gene, which also exhibits glutathione transferase activity, further implicating its importance in detoxification processes. Research on the recombinant protein of Maleylacetoacetate isomerase/GSTZ1 focuses on understanding its structural characteristics, catalytic mechanisms, and functional roles in metabolism. Detailed studies, including crystallography and kinetic analyses, aim to elucidate the interaction of MAAi with substrates and inhibitors, providing insights into potential therapeutic approaches for treating metabolic disorders. The recombinant expression of GSTZ1 facilitates its purification and characterization, enabling researchers to explore its enzymatic properties, stability, and the effects of genetic variations associated with human diseases. This research is essential for developing targeted treatments and understanding the biochemical pathways implicated in tyrosine metabolism, ultimately contributing to better diagnostics and therapeutic strategies for related metabolic disorders.
