Cat: IPD-X33355

Recombinant Human CDK4 Protein (Baculovirus),Avi & His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CDK4

  • 简介

    CDK4 protein, acting as a Ser/Thr kinase in the cyclin D-CDK4 complex, critically regulates the G(1)/S transition by phosphorylating and inhibiting RB family members. This activity, specifically hypophosphorylation of RB1 during early G(1) phase, releases E2F and promotes transcription of genes that drive G(1) progression. CDK4 Protein, Human (sf9, His, Avi) is the recombinant human-derived CDK4, expressed by Sf9 insect cells, with N-Avi, N-His labeled tag. The total length of CDK4 Protein, Human (sf9, His, Avi) is 303 a.a..

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CDK4; Cell division protein kinase 4; CMM3; PSK-J3

  • Species

    Human

  • Source

    Baculovirus

  • Tag

    N-Avi;N-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P11802-1

  • Expression Region

    M1-E303

  • AA Sequence

    MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE

  • Protein Length

    Full Length of Isoform-1

  • Molecular Weight

    38.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CDK4 (Cyclin-Dependent Kinase 4) is a pivotal regulatory enzyme in the cell cycle, primarily responsible for driving the transition from the G1 phase to the S phase, thus facilitating cellular proliferation. Its activity is modulated by association with cyclin D and is critical for executing mitogenic signals. Dysregulation of CDK4 is frequently associated with various cancers, as overexpression or mutations can lead to uncontrolled cell division. Consequently, CDK4 has emerged as a significant target for therapeutic intervention in cancer treatment. The study of recombinant CDK4 proteins allows researchers to investigate the enzyme's structure, function, and interactions at a molecular level. This recombinant approach provides purified CDK4 for in vitro assays, enabling the exploration of its enzymatic activity, binding partners, and the effects of potential inhibitors. Furthermore, understanding the kinetic properties and regulatory mechanisms governing CDK4 can offer insights into how cancer cells evade normal growth controls. With the advent of potent CDK4 inhibitors, such as palbociclib, understanding the molecular underpinnings of CDK4 function has become increasingly relevant for developing effective cancer therapies. Thus, the research on CDK4 recombinant proteins serves as a crucial component of efforts to delineate the intricacies of cell cycle regulation and devise novel strategies for cancer treatment.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US