Analytical Data
-
Gene name
HLA-DPA1
-
简介
The HLA-DPA1 protein is critical in the immune system, binding antigens in the endocytic pathway of APCs and presenting them to the cell surface for recognition by CD4 T cells. The peptide binding cleft can accommodate peptides of 10-30 residues, mainly resulting from protein degradation. HLA-DPA1 Protein, Human (His) is the recombinant human-derived HLA-DPA1 protein, expressed by E. coli , with N-His labeled tag.
- Application
-
Alternative Names
HLA-DPA1; HLA-DP1A; HLASBHLA class II histocompatibility antigen; DP alpha 1 chain; HLA-SB alpha chain; MHC class II DP3-alpha; MHC class II DPA1
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P20036
-
Expression Region
A29-E222
-
AA Sequence
AGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTE
-
Protein Length
Extracellular Domain
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HLA-DPA1 is a vital component of the human immune system, specifically a gene that encodes for a subunit of the major histocompatibility complex (MHC) class II molecules. These molecules play a critical role in the immune response by presenting peptides derived from extracellular proteins to CD4+ T cells, thereby facilitating immune recognition and activation. Research into HLA-DPA1 is particularly significant due to its association with various autoimmune diseases and transplant compatibility. Variations in the HLA-DPA1 gene can influence susceptibility to conditions such as type 1 diabetes and rheumatoid arthritis, highlighting its potential as a biomarker for disease risk and treatment responses. Moreover, understanding the structure and function of HLA-DPA1 can aid in developing therapeutic strategies and enhancing organ transplantation outcomes through better donor-recipient matching. As recombinant proteins of HLA-DPA1 are increasingly used in experimental and clinical settings, studies focus on optimizing expression systems, understanding their biophysical properties, and exploring mechanisms of antigen presentation. This research is crucial for advancing personalized medicine approaches and addressing immune-related disorders.











