Analytical Data
-
Gene name
HLA-DPB1
- Application
-
Alternative Names
HLA class II histocompatibility antigen; HLA class II histocompatibility antigen; DP beta 1 chain; HLA class II histocompatibility antigen; HLA-DP1B; HLA-DPB
-
Species
Human
-
Source
E. coli
-
Tag
N-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P04440
-
Expression Region
R30-R223
-
AA Sequence
RATPENYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSAR
-
Protein Length
Extracellular Domain
-
Molecular Weight
26.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HLA-DPB1, a member of the human leukocyte antigen (HLA) class II molecule family, plays a crucial role in the immune response by presenting peptide antigens to CD4+ T cells. Its polymorphic nature contributes to the diversity of immune responses among individuals, making it significant in transplantation, autoimmune diseases, and infectious disease susceptibility. Research into HLA-DPB1 has gained attention due to its association with various clinical conditions, particularly in the context of organ transplantation, where mismatches can lead to graft rejection. Additionally, certain HLA-DPB1 alleles have been linked to the risk of diseases such as asthma, rheumatoid arthritis, and certain cancers, highlighting its importance in understanding disease mechanisms and potential therapeutic targets. The recombinant expression of HLA-DPB1 proteins allows for in-depth studies on their structural properties, function, and interactions with T cell receptors, which are essential for deciphering the complexities of immune responses. This research can ultimately lead to advancements in personalized medicine, including tailored immunotherapies and improved transplantation outcomes. Consequently, the study of HLA-DPB1 recombinant proteins has far-reaching implications for immunology and therapeutic interventions in various diseases.











