Cat: IPD-X25338

Recombinant Human HLA-DPB1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HLA-DPB1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HLA class II histocompatibility antigen; HLA class II histocompatibility antigen; DP beta 1 chain; HLA class II histocompatibility antigen; HLA-DP1B; HLA-DPB

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P04440

  • Expression Region

    R30-R223

  • AA Sequence

    RATPENYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSAR

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    26.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HLA-DPB1, a member of the human leukocyte antigen (HLA) class II molecule family, plays a crucial role in the immune response by presenting peptide antigens to CD4+ T cells. Its polymorphic nature contributes to the diversity of immune responses among individuals, making it significant in transplantation, autoimmune diseases, and infectious disease susceptibility. Research into HLA-DPB1 has gained attention due to its association with various clinical conditions, particularly in the context of organ transplantation, where mismatches can lead to graft rejection. Additionally, certain HLA-DPB1 alleles have been linked to the risk of diseases such as asthma, rheumatoid arthritis, and certain cancers, highlighting its importance in understanding disease mechanisms and potential therapeutic targets. The recombinant expression of HLA-DPB1 proteins allows for in-depth studies on their structural properties, function, and interactions with T cell receptors, which are essential for deciphering the complexities of immune responses. This research can ultimately lead to advancements in personalized medicine, including tailored immunotherapies and improved transplantation outcomes. Consequently, the study of HLA-DPB1 recombinant proteins has far-reaching implications for immunology and therapeutic interventions in various diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US