Analytical Data
-
Gene name
AXL
-
简介
The AXL protein has predicted roles in various cellular functions, binds to phosphatidylinositol 3-kinase and phosphatidylserine, and serves as a viral receptor. It negatively regulates apoptosis and positively regulates protein kinase B signaling. AXL Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived AXL protein, expressed by HEK293 , with C-hFc, C-His labeled tag.
- Application
-
Biological Activity
Immobilized AXL at 2 μg/mL (100 μL/well) can bind Biotinylated GAS6 protein. The ED50 for this effect is 9.284 ng/mL, corresponding to a specific activity is 1.08×10^5 Unit/mg. Immobilized AXL at 2 μg/mL (100 μL/well) can bind Biotinylated GAS6 protein. The ED50 for this effect is 9.284 ng/mL, corresponding to a specific activity is 1.08×105Unit/mg.
-
Alternative Names
Tyrosine-protein kinase receptor UFO; AXL oncogene; UFO
-
Species
Mouse
-
Source
HEK293
-
Tag
C-hFc;C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
NP_033491.2
-
Expression Region
H20-P443
-
AA Sequence
HKDTQTEAGSPFVGNPGNITGARGLTGTLRCELQVQGEPPEVVWLRDGQILELADNTQTQVPLGEDWQDEWKVVSQLRISALQLSDAGEYQCMVHLEGRTFVSQPGFVGLEGLPYFLEEPEDKAVPANTPFNLSCQAQGPPEPVTLLWLQDAVPLAPVTGHSSQHSLQTPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQRPHHLHVVSRQPTELEVAWTPGLSGIYPLTHCNLQAVLSDDGVGIWLGKSDPPEDPLTLQVSVPPHQLRLEKLLPHTPYHIRISCSSSQGPSPWTHWLPVETTEGVPLGPPENVSAMRNGSQVLVRWQEPRVPLQGTLLGYRLAYRGQDTPEVLMDIGLTREVTLELRGDRPVANLTVSVTAYTSAGDGPWSLPVPLEPWRPGQGQPLHHLVSEPPPRAFSWP
-
Protein Length
Partial
-
Molecular Weight
95-120 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AXL is a receptor tyrosine kinase that plays a significant role in various cellular processes, including cell proliferation, survival, and migration. Originally discovered for its involvement in cancer progression and metastasis, AXL has garnered considerable attention in recent years due to its association with poor prognosis in multiple malignancies, particularly lung cancer and acute myeloid leukemia. The expression of AXL is often upregulated in response to external stimuli such as cytokines and growth factors, leading to the activation of downstream signaling pathways that promote tumorigenesis and therapy resistance. Researchers have been investigating AXL-targeted therapies, including monoclonal antibodies and small molecule inhibitors, as potential strategies to halt cancer progression and enhance the efficacy of existing treatments. The study of AXL recombinant proteins has become crucial for understanding its structure, function, and interaction with various ligands, particularly its ligand, Gas6. By producing and characterizing AXL recombinant proteins, scientists aim to elucidate the mechanisms of AXL signaling and its impact on cancer biology. The knowledge gained from these studies may pave the way for innovative therapeutic approaches targeting AXL, ultimately contributing to more effective cancer treatment strategies and improving patient outcomes.











