Analytical Data
-
Gene name
AXL
- Application
-
Alternative Names
rMuAXL, His; Tyrosine-protein kinase receptor UFO; AXL oncogene; UFO
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q00993
-
Expression Region
A19-P443
-
AA Sequence
AHKDTQTEAGSPFVGNPGNITGARGLTGTLRCELQVQGEPPEVVWLRDGQILELADNTQTQVPLGEDWQDEWKVVSQLRISALQLSDAGEYQCMVHLEGRTFVSQPGFVGLEGLPYFLEEPEDKAVPANTPFNLSCQAQGPPEPVTLLWLQDAVPLAPVTGHSSQHSLQTPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQRPHHLHVVSRQPTELEVAWTPGLSGIYPLTHCNLQAVLSDDGVGIWLGKSDPPEDPLTLQVSVPPHQLRLEKLLPHTPYHIRISCSSSQGPSPWTHWLPVETTEGVPLGPPENVSAMRNGSQVLVRWQEPRVPLQGTLLGYRLAYRGQDTPEVLMDIGLTREVTLELRGDRPVANLTVSVTAYTSAGDGPWSLPVPLEPWRPGQGQPLHHLVSEPPPRAFSWPHHHHHH
-
Protein Length
Extracellular Domain
-
Molecular Weight
60-80 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AXL is a receptor tyrosine kinase that plays a significant role in various cellular processes, including cell proliferation, survival, and migration. Originally discovered for its involvement in cancer progression and metastasis, AXL has garnered considerable attention in recent years due to its association with poor prognosis in multiple malignancies, particularly lung cancer and acute myeloid leukemia. The expression of AXL is often upregulated in response to external stimuli such as cytokines and growth factors, leading to the activation of downstream signaling pathways that promote tumorigenesis and therapy resistance. Researchers have been investigating AXL-targeted therapies, including monoclonal antibodies and small molecule inhibitors, as potential strategies to halt cancer progression and enhance the efficacy of existing treatments. The study of AXL recombinant proteins has become crucial for understanding its structure, function, and interaction with various ligands, particularly its ligand, Gas6. By producing and characterizing AXL recombinant proteins, scientists aim to elucidate the mechanisms of AXL signaling and its impact on cancer biology. The knowledge gained from these studies may pave the way for innovative therapeutic approaches targeting AXL, ultimately contributing to more effective cancer treatment strategies and improving patient outcomes.











