Analytical Data
-
Gene name
VSNL1
-
简介
VSNL1 mediates rhodopsin phosphorylation inhibition in vitro and its activity is dependent on calcium levels. This implies that VSNL1 plays a role in regulating rhodopsin phosphorylation dynamics, which is critical for photoreceptor cell signaling. VSNL1 Protein, Human (His) is the recombinant human-derived VSNL1 protein, expressed by E. coli , with N-6*His labeled tag.
- Application
-
Alternative Names
Visinin-Like Protein 1; VILIP; VLP-1; Hippocalcin-Like Protein 3; HLP3; VSNL1; VISL1
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P62760
-
Expression Region
M1-K191
-
AA Sequence
MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK
-
Protein Length
Full Length
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VSNL1, or Vascular Smooth Muscle Cell-specific Neurotransmitter-like Protein 1, is a member of the vascular smooth muscle cell (VSMC) protein family that plays a critical role in various physiological and pathological processes, including vascular development, homeostasis, and disease progression. Research into VSNL1 has gained traction due to its potential implications in cardiovascular diseases, such as hypertension and atherosclerosis. Evidence suggests that VSNL1 is involved in signaling pathways that regulate smooth muscle contraction and cell proliferation. Furthermore, its expression levels have been linked to pathological changes in blood vessels, making it a candidate biomarker for vascular diseases. Understanding the structure and function of VSNL1 through recombinant protein studies allows for detailed investigations into its biological activities and interactions. Such studies enable researchers to explore the molecular mechanisms underlying VSMC behavior and evaluate VSNL1 as a potential therapeutic target. The creation of recombinant VSNL1 proteins facilitates the development of assays to assess its functional effects, providing insights that could inform new treatment strategies for vascular-related conditions. As cardiovascular diseases remain a leading cause of morbidity and mortality globally, the elucidation of VSNL1’s role in vascular biology could open new avenues for clinical applications and enhance our understanding of smooth muscle cell regulation.











