Analytical Data
-
Gene name
EphB2
-
简介
EphB2 protein is a receptor tyrosine kinase that participates in bidirectional signaling with the transmembrane ephrin B ligand. It guides commissural axons in the developing cerebral cortex, efferent growth cones of the inner ear, and retinal ganglion cell axons. EphB2 Protein, Human (sf9, His-GST) is the recombinant human-derived EphB2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
- Application
-
Alternative Names
EPHB2; Ephrin type-B receptor 2; EK5; DRT; EPHT3; ERK; HEK5; TYRO5
-
Species
Human
-
Source
Baculovirus
-
Tag
N-His;N-GST
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P29323-3
-
Expression Region
G570-V987
-
AA Sequence
GFERADSEYTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEV
-
Protein Length
Partial
-
Molecular Weight
65 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EphB2 is a member of the Eph receptor tyrosine kinase family, which plays a critical role in various biological processes, including cell adhesion, migration, and axon guidance. The EphB2 protein has garnered significant interest due to its involvement in neurodevelopment and potential implications in cancer biology, particularly its association with tumor progression and metastasis. Aberrant expression of EphB2 has been linked to various malignancies, making it a target for cancer therapeutics. Research has shown that EphB2 can modulate tumor microenvironments and influence the behavior of both tumor cells and neighboring stromal cells. In this context, the recombinant expression of EphB2 provides a valuable tool for biochemical and biophysical studies, enabling the exploration of its structure-function relationships and interactions with ligands such as ephrin-Bs. Furthermore, the generation of EphB2 recombinant proteins facilitates the development of assays for high-throughput screening of small molecules or antibodies that could inhibit or enhance its activity. This line of research holds promise for uncovering novel therapeutic strategies for diseases associated with EphB2 dysregulation, ultimately contributing to improved outcomes for patients facing aggressive cancers.











