Cat: IPD-X32990

Recombinant Cynomolgus EphA10 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    EphA10

  • 简介

    EphA10, a receptor for ephrin-A family members, selectively binds EFNA3, EFNA4, and EFNA5, indicating its involvement in mediating cellular responses to ephrin-A ligands and participating in diverse cellular processes regulated by Eph-ephrin signaling pathways. EPHA10 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived EPHA10 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. When Cynomolgus EPHA10 is coated at 5 μg/mL (100 μL/well) can bind Human Ephrin-A3. The ED50 for this effect is 1.106 ng/mL. Measured by its binding ability in a functional ELISA. When Cynomolgus EPHA10 is coated at 5 μg/mL (100 μL/well) can bind Human Ephrin-A3. The ED50 for this effect is 1.106 ng/mL.

  • Alternative Names

    EphA10; FLJ16103; FLJ33655; MGC43817

  • Species

    Cynomolgus

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    XP_045230088.1

  • Expression Region

    E34-A565

  • AA Sequence

    EEVILLDSKASQAELGWTALPSNGWEEISGVDEHDRPIRTYQVCNVLEPNQDNWLQTGWISRGRGQRIFVELQFTLRDCSSIPGAAGTCKETFNVYYLETEADLGRGRPRLGGSRPRKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSRRGFHLAFQDVGACVALVSVRVYYKQCRATVRGLAAFPATAAESAFSTLVEVAGTCVAHSEGEPGSPPRMHCGADGEWLVPVGRCSCSAGFQERGDICEACPPGFYKVSPRRPLCSPCPEHSRALENASTFCVCQDSYARSPTDPPSASCTRPPSAPRDLQYSLSRSPLALRLRWLPPADSGGRSDVTYSLLCLRCGREGPAGACEPCGPRVAFVPRQAGLRERAATLLHLRPGARYTVRVAALNGVSGPAAAAGATYAQVTVSTGPGAPWEEDEIRRERVEPQSVSLSWREPIPAGAPGANGTEYEIRYYEKGQSEQTYSMVKTGAPTVTVTNLKPATRYVFQIRAASPGPSWEAQSFNPSIEVQTPGEAASGSRDQSPA

  • Molecular Weight

    68-80 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

EphA10 is a member of the Eph receptor tyrosine kinase family, which plays crucial roles in various biological processes, including cell signaling, tissue morphogenesis, and neuronal development. Unlike other Eph receptors, EphA10 is expressed in specific tissues, including the brain, and is implicated in cancer progression and metastasis. Recent studies have suggested that EphA10 may serve as a biomarker for certain types of tumors and could be a potential therapeutic target for novel cancer treatments. The development of recombinant EphA10 protein allows for detailed investigation into its structure and function, providing insights into the molecular mechanisms by which EphA10 influences cellular behaviors. This research not only aims to characterize the EphA10 protein's signaling pathways but also explores its interactions with ligands and other proteins, contributing to the understanding of its role in both normal physiology and pathological conditions. The creation of a recombinant EphA10 protein could facilitate drug discovery efforts, enabling the design of targeted therapies that disrupt the oncogenic signaling pathways associated with EphA10, thereby advancing the field of precision medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US