Analytical Data
-
Gene name
TIM-4/TIMD-4
-
简介
T-cell immunoglobulin and mucin domain-containing protein 4 (TIMD4, TIM4) is a membrane protein in TIM family and is a phosphatidylserine receptor that plays different role in immune response including phagocytosis of apoptotic cells and T-cell regulation. TIMD4 controls T-cell activation in a bimodal fashion and promots the engulfment against apoptotic cells or exogenous particles. TIM-4/TIMD-4 Protein, Human (HEK293, His) is the recombinant human-derived TIM-4/TIMD-4 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
T-cell immunoglobulin and mucin domain-containing protein 4; TIMD-4; T-cell immunoglobulin mucin receptor 4; TIM-4; T-cell membrane protein 4; TIMD4; TIM4
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
AAH08988.1
-
Expression Region
E25-L315
-
AA Sequence
ETVVTEVLGHRVTLPCLYSSWSHNSNSMCWGKDQCPYSGCKEALIRTDGMRVTSRKSAKYRLQGTIPRGDVSLTILNPSESDSGVYCCRIEVPGWFNDVKINVRLNLQRASTTTHRTATTTTRRTTTTSPTTTRQMTTTPAALPTTVVTTPDLTTGTPLQMTTIAVFTTANTCLSLTPSTLPEEATGLLTPEPSKEGPILTAESETVLPSDSWSSAESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQPGASDTAVPEQNKTTKTGQMDGIPMSMKNEMPISQL
-
Protein Length
Partial
-
Molecular Weight
60-90 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TIM-4 (T cell immunoglobulin and mucin domain-containing protein 4) is a member of the TIM family, which plays a crucial role in immune regulation. TIM-4 is primarily expressed on antigen-presenting cells, such as dendritic cells and macrophages, where it interacts with TIM-1 on T cells, thereby influencing T cell activation and differentiation. This interaction can have significant implications for immune responses, particularly in contexts such as allergy, autoimmunity, and cancer. The study of recombinant TIM-4 and its interactions with TIM-1 is essential for understanding the mechanisms underlying immune regulation and for developing potential therapeutic strategies targeting TIM-4. Research has shown that TIM-4 can modulate T cell responses, enhancing or inhibiting activation depending on the context, making it a key player in immunological balance. Additionally, recombinant TIM-4 proteins have been explored for their potential as biomarkers and therapeutic targets in various diseases. As the understanding of TIM-4/TIM-1 signaling pathways advances, it opens new avenues for manipulating immune responses, offering hope for innovative treatments in immune-mediated diseases and improving the efficacy of cancer immunotherapies.
