Analytical Data
-
Gene name
PRSS3/Trypsin-3
-
简介
PRSS3/Trypsin-3 is a digestive protease with specific substrate preference that cleaves proteins after Arg residues. This enzymatic activity is combined with its ability to exhibit proteolytic effects on Kunitz-type trypsin inhibitors. PRSS3/Trypsin-3 Protein, Human (His) is the recombinant human-derived PRSS3/Trypsin-3 protein, expressed by E. coli , with N-6*His labeled tag.
- Application
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35030
-
Expression Region
I81-N303
-
AA Sequence
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAAN
-
Protein Length
Partial
-
Molecular Weight
28.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PRSS3, also known as Trypsin-3, is a serine protease belonging to the trypsin-like family of enzymes, playing a significant role in various physiological processes, including digestion and immune response. Its unique specificity for basic amino acids such as lysine and arginine makes it essential for processing a wide range of proteins in the gastrointestinal tract. Research on PRSS3 has gained momentum due to its association with several pathological conditions, including chronic pancreatitis, cancer, and inflammatory diseases. The production of recombinant PRSS3 proteins has become crucial for understanding its enzymatic functions, substrate interactions, and regulatory mechanisms. By utilizing advanced molecular cloning and expression systems, researchers can assess the impact of this protease in both health and disease models. Furthermore, studying PRSS3 can lead to the identification of potential therapeutic targets and biomarkers for various diseases, enhancing our understanding of protease biology and its implications in human health. This background sets the stage for ongoing investigations into the structural and functional dynamics of PRSS3, with the aim of exploiting its unique characteristics for biomedical applications.
