Analytical Data
-
Gene name
TPSAB1
-
简介
Tryptase alpha/beta 1 protein (TPSAB1) belongs to a family of trypsin-like serine proteases, and is enzymatically active and get involved in proteolysis only as heparin-stabilized tetramers, TPSAB1 is also resistant to all known endogenous proteinase inhibitors. Beta tryptase appears to be the main isoenzymes expressed in mast cells; while alpha tryptase is predominate in basophils. TPSAB1 Protein, Human (HEK293, His) is the recombinant human-derived TPSAB1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
tryptase alpha/beta 1; Tryptase 1; TPS1; TPS2; TPSAB1; TPSB1
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86TM8
-
Expression Region
I31-P275
-
AA Sequence
IVGGQEAPRSKWPWQVSLRVRDRYWMHFCGGSLIHPQWVLTAAHCLGPDVKDLATLRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSRVHTVMLPPASETFPPGMPCWVTGWGDVDNDEPLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIIRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWDEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
-
Protein Length
Partial
-
Molecular Weight
32-37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TPSAB1, or Tryptase Beta-1, is a serine protease predominantly produced by mast cells and plays a crucial role in various physiological and pathological processes, including inflammation, allergy, and tissue remodeling. Research into TPSAB1 has gained significant attention due to its involvement in immune responses and its potential implications in allergic diseases like asthma and anaphylaxis. The enzyme is known for its ability to activate other proteases and to cleave various substrates, contributing to the inflammatory cascade. Furthermore, genetic variations in the TPSAB1 gene have been associated with susceptibility to certain diseases, making it a target for therapeutic interventions. The recombination and expression of TPSAB1 in various systems allow for the detailed study of its structure, function, and mechanisms of action. Such studies aim to elucidate the roles of TPSAB1 in mast cell biology and its contributions to inflammatory pathways, which could lead to novel strategies for the treatment of allergic conditions and other mast cell-related diseases. The exploration of TPSAB1 as a recombinant protein may also pave the way for the development of specific inhibitors or modulators, enhancing our understanding of its biological significance and therapeutic potential. This research not only advances the field of immunology but also holds promise for improving clinical outcomes in patients suffering from mast cell-related disorders.











