Analytical Data
-
Gene name
SULT1E1
-
简介
The SULT1E1 protein is a sulfotransferase that critically regulates estrogen homeostasis by sulfating estradiol and estrone, resulting in hormone inactivation. Its versatility extends to sulfated DHEA, pregnenolone, and xenobiotics such as ethinyl estradiol. SULT1E1 Protein, Human (N-His) is the recombinant human-derived SULT1E1 protein, expressed by E. coli , with N-His labeled tag.
- Application
-
Alternative Names
Sulfotransferase 1E1; ST1E1; EST-1; Estrogen sulfotransferase; STE
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P49888
-
Expression Region
N2-I294
-
AA Sequence
NSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRTEI
-
Protein Length
Partial
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SULT1E1, a member of the sulfotransferase family, plays a crucial role in the metabolism of hormones, neurotransmitters, and xenobiotics by catalyzing the sulfonation process, which enhances solubility and facilitates excretion. Its involvement in estrogen metabolism, particularly in the sulfonation of estradiol, positions SULT1E1 as a significant player in both reproductive health and endocrine regulation. Dysregulation of SULT1E1 expression has been linked to various conditions, including hormone-related cancers, making it a target for therapeutic intervention and biomarker studies. The recombinant expression of SULT1E1 is critical for understanding its structure-function relationships and substrate specificity, which can provide insights into its biological roles and potential as a drug target. Advances in molecular biology techniques have enabled the production of SULT1E1 in heterologous systems, facilitating large-scale studies and functional assays. Research into SULT1E1 not only contributes to our comprehension of steroid hormone metabolism but also sheds light on individual variability in drug metabolism and susceptibility to diseases, highlighting its importance in pharmacogenomics and toxicology. Overall, the study of SULT1E1 through recombinant protein techniques holds promise for developing novel therapeutic approaches and improving our understanding of sulfonation pathways in human health.
