Analytical Data
-
Gene name
Histo-blood group ABO/ABO
-
简介
The Histo-blood group ABO/ABO Protein is an enzyme encoded by the human ABO gene with glycosyltransferase activity. ABO Protein is associated with a variety of infectious and non-communicable diseases. ABO blood group can be used as a tumor marker. Histo-blood group ABO/ABO Protein, Human (HEK293, Fc) is the recombinant human-derived Histo-blood group ABO/ABO protein, expressed by HEK293 , with N-hFc labeled tag.
- Application
-
Alternative Names
Histo-blood group ABO system transferase; ABO; NAGAT
-
Species
Human
-
Source
HEK293
-
Tag
N-hFc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
ADX99264
-
Expression Region
R63-P354
-
AA Sequence
RVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP
-
Protein Length
Partial
-
Molecular Weight
62-68 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of Histo-blood group ABO/ABO recombinant proteins is rooted in the understanding of blood group antigens, which play a crucial role in transfusion medicine and organ transplantation. The ABO blood group system, discovered in the early 20th century, categorizes human blood into four main types: A, B, AB, and O, based on the presence or absence of specific glycoproteins on the surface of red blood cells. These antigens not only influence compatibility in blood transfusions but also have been implicated in varying susceptibility to certain diseases, making them significant in immunology and genetics. Recombinant proteins of ABO antigens can be produced using advanced biotechnological methods, allowing researchers to study their biochemical properties and interactions more precisely. This research is not only vital for improving transfusion safety and efficacy but also for developing immunotherapeutics and vaccines that leverage the immune response related to ABO antigens. Moreover, understanding these proteins contributes to the ongoing exploration of their roles in cell signaling and disease pathology, which could lead to novel therapeutic approaches. As such, the study of Histo-blood group ABO/ABO recombinant proteins represents a significant intersection of transfusion medicine, immunology, and molecular biology, paving the way for innovative strategies in patient care and disease prevention.
