Cat: IPD-X36961

Recombinant Human Histo-blood group ABO/ABO Protein (HEK293),hFc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Histo-blood group ABO/ABO

  • 简介

    The Histo-blood group ABO/ABO Protein is an enzyme encoded by the human ABO gene with glycosyltransferase activity. ABO Protein is associated with a variety of infectious and non-communicable diseases. ABO blood group can be used as a tumor marker. Histo-blood group ABO/ABO Protein, Human (HEK293, Fc) is the recombinant human-derived Histo-blood group ABO/ABO protein, expressed by HEK293 , with N-hFc labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Histo-blood group ABO system transferase; ABO; NAGAT

  • Species

    Human

  • Source

    HEK293

  • Tag

    N-hFc

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    ADX99264

  • Expression Region

    R63-P354

  • AA Sequence

    RVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP

  • Protein Length

    Partial

  • Molecular Weight

    62-68 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of Histo-blood group ABO/ABO recombinant proteins is rooted in the understanding of blood group antigens, which play a crucial role in transfusion medicine and organ transplantation. The ABO blood group system, discovered in the early 20th century, categorizes human blood into four main types: A, B, AB, and O, based on the presence or absence of specific glycoproteins on the surface of red blood cells. These antigens not only influence compatibility in blood transfusions but also have been implicated in varying susceptibility to certain diseases, making them significant in immunology and genetics. Recombinant proteins of ABO antigens can be produced using advanced biotechnological methods, allowing researchers to study their biochemical properties and interactions more precisely. This research is not only vital for improving transfusion safety and efficacy but also for developing immunotherapeutics and vaccines that leverage the immune response related to ABO antigens. Moreover, understanding these proteins contributes to the ongoing exploration of their roles in cell signaling and disease pathology, which could lead to novel therapeutic approaches. As such, the study of Histo-blood group ABO/ABO recombinant proteins represents a significant intersection of transfusion medicine, immunology, and molecular biology, paving the way for innovative strategies in patient care and disease prevention.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US