Analytical Data
-
Gene name
METAP1D/Methionine aminopeptidase 1D
-
简介
METAP1D or methionine aminopeptidase 1D plays a crucial role in protein maturation, catalyzing the removal of N-terminal methionine from nascent proteins. Its activity is prominent in the smaller, uncharged second residue (Met-Ala, Cys, Gly, Pro, Ser, Thr or Val). METAP1D/Methionine aminopeptidase 1D Protein, Human (His) is the recombinant human-derived METAP1D/Methionine aminopeptidase 1D protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.
- Application
-
Alternative Names
Methionine Aminopeptidase 1D Mitochondrial; Methionyl Aminopeptidase Type 1D Mitochondrial; METAP1D; MAP1D
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His;C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UB28
-
Expression Region
R44-A335
-
AA Sequence
RQRDISHSIVLPAAVSSAHPVPKHIKKPDYVTTGIVPDWGDSIEVKNEDQIQGLHQACQLARHVLLLAGKSLKVDMTTEEIDALVHREIISHNAYPSPLGYGGFPKSVCTSVNNVLCHGIPDSRPLQDGDIINIDVTVYYNGYHGDTSETFLVGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSYFHGHPEIWHHANDSDLPMEEGMAFTIEPIITEGSPEFKVLEDAWTVVSLDNQRSAQFEHTVLITSRGAQILTKLPHEA
-
Protein Length
Partial
-
Molecular Weight
35-40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Methionine aminopeptidase 1D (METAP1D) is an enzyme involved in the post-translational modification of proteins, specifically the removal of methionine residues from the amino-terminal end of nascent peptides. This process is crucial for various cellular functions, including protein maturation, stability, and regulation. Abnormalities in METAP1D activity have been linked to several diseases, including certain cancers and neurodegenerative disorders, highlighting its potential as a therapeutic target. The study of recombinant METAP1D has gained traction due to the need for detailed understanding of its enzymatic mechanisms, substrate specificity, and interactions with other cellular components. Recombinant protein production allows researchers to obtain large quantities of METAP1D for functional assays, structural analysis, and potential drug screening. Current research focuses on elucidating the crystal structure of METAP1D to gain insights into its catalytic mechanism and develop inhibitors that can modulate its activity. Moreover, understanding the role of METAP1D in protein processing pathways can provide valuable information for developing strategies to combat diseases associated with its dysfunction. As research in this area progresses, METAP1D is not only expected to enhance our grasp of fundamental biological processes but also pave the way for innovative therapeutic approaches in treating related disorders.
