Analytical Data
-
Gene name
LACTB2
-
简介
As an endoribonuclease, LACTB2 protein preferentially cleaves the 3' purine-pyrimidine dinucleotide motif within single-stranded RNA, producing a cleavage product with a free 3'-OH group. It is worth noting that its enzymatic activity is only directed against single-stranded RNA and does not extend to double-stranded RNA or DNA. LACTB2 Protein, Human (GST) is the recombinant human-derived LACTB2 protein, expressed by E. coli , with N-GST labeled tag.
- Application
-
Alternative Names
Beta-Lactamase-Like Protein 2; LACTB2
-
Species
Human
-
Source
E. coli
-
Tag
N-GST
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q53H82
-
Expression Region
M1-L288
-
AA Sequence
MAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL
-
Protein Length
Full Length
-
Molecular Weight
56 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LACTB2, a member of the lactoylglutathione lyase family, has recently garnered attention for its potential roles in cellular functions and disease mechanisms. This protein is implicated in critical biological processes, including oxidative stress response and metabolic regulation. Initial studies have suggested that LACTB2 may act as a regulator of apoptosis and inflammation, highlighting its relevance in cancer and neurodegenerative disorders. Despite its importance, the functional characterization of LACTB2 remains limited, with many of its biochemical pathways and interactors still unidentified. Recent advancements in proteomics and structural biology have opened new avenues for understanding LACTB2’s role at the molecular level. Recombinant expression of LACTB2 offers a promising approach to investigate its enzymatic activity, substrate specificity, and role in cellular signaling pathways. By producing LACTB2 in a controlled laboratory setting, researchers aim to elucidate its functional properties, paving the way for potential therapeutic strategies targeting LACTB2-related pathways. Furthermore, understanding the regulatory mechanisms involving LACTB2 may provide insights into its contribution to various pathophysiological conditions, ultimately leading to the identification of novel biomarkers or drug targets. Thus, the study of LACTB2 as a recombinant protein holds significant promise for advancing our knowledge of its biological functions and therapeutic potential, making it a focal point of research in the fields of biochemistry and molecular biology.
