Analytical Data
-
Gene name
Follistatin/FST
-
简介
Follistatin (FST) is a regulator of TGFβ family signaling and acts by selectively binding to TGFβ family ligands and preventing ligand binding to the receptor complex. Follistatin has the ability to suppress the follicle stimulating hormone (FSH)[1][2]. Follistatin/FST Protein, Human (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag.
- Application
-
Biological Activity
Measured by its ability to neutralize Activin A inhibitory effect of murine MPC-11 cells. The ED50 this effect is 0.3271 μg/ml in the presence of 7.5 ng/mL Activin A, corresponding to a specific activity is 3.06×10^3 units/mg. Measured by its ability to neutralize Activin A inhibitory effect of murine MPC-11 cells. The ED50 for this effect is 0.3271 μg/ml in the presence of 7.5 ng/mL Activin A, corresponding to a specific activity is 3.06×103 units/mg.
-
Alternative Names
Follistatin; FS; Activin-binding protein; FST
-
Species
Human
-
Source
HEK293
-
Tag
C-hFc
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
P19883-1
-
Expression Region
G30-W344
-
AA Sequence
GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Molecular Weight
70-72 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Follistatin (FST) is a powerful glycoprotein that functions primarily as an antagonist of members of the transforming growth factor-beta (TGF-β) superfamily, particularly activins and myostatin. The research on FST has gained significant momentum due to its implications in various biological processes, including muscle growth, reproductive functions, and tissue repair. Follistatin's ability to inhibit myostatin—a negative regulator of muscle mass—has attracted attention in the field of muscle physiology and regenerative medicine, as potential therapies targeting FST may enhance muscle growth in conditions such as muscular dystrophy and age-related muscle wasting. Additionally, FST plays a vital role in regulating fibrosis and inflammation, making it a promising candidate for therapeutic interventions in fibrotic diseases and metabolic disorders. Advances in recombinant DNA technology have enabled the production of recombinant FST proteins, facilitating the exploration of their therapeutic potential through preclinical and clinical studies. As a result, ongoing research aims to elucidate the precise mechanisms of FST action, optimize its therapeutic applications, and investigate its role in various diseases, paving the way for innovative strategies to manipulate muscle and tissue health.











