Cat: IPD-X11562

Recombinant Mouse Follistatin/FST Protein(HEK293), C-10*His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Follistatin/FST

  • 简介

    Follistatin (FST) is a regulator of TGFβ family signaling and acts by selectively binding to TGFβ family ligands and preventing ligand binding to the receptor complex. Follistatin has the ability to suppress the follicle stimulating hormone (FSH)[1][2]. Follistatin/FST Protein, Mouse (HEK293, His) is produced in HEK293 cells with a C-Terminal 10*His-tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    1. Measured by its ability to neutralize Activin-mediated inhibition on MPC11 cell proliferation and the ED50 is 0.01-0.08 μg/mL in the presence of 10 ng/mL Human Activin A. 2. Measured in a cell proliferation assay using MPC-11 cells. The ED50 this effect is <0> 2×103 units/mg. Measured in a cell proliferation assay using MPC-11 cells. The ED50 this effect is 0.177 μg/ml, corresponding to a specific activity is 5.65×103 units/mg.

  • Alternative Names

    Follistatin; FS; Activin-binding protein; FST

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-10*His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE

  • Uniprot

    P47931-1

  • Expression Region

    G30-W344

  • AA Sequence

    GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPSSSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCGGGKKCLWDSKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEETEEEEEEEDQDYSFPISSILEW

  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Molecular Weight

    43-54 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Follistatin (FST) is a powerful glycoprotein that functions primarily as an antagonist of members of the transforming growth factor-beta (TGF-β) superfamily, particularly activins and myostatin. The research on FST has gained significant momentum due to its implications in various biological processes, including muscle growth, reproductive functions, and tissue repair. Follistatin's ability to inhibit myostatin—a negative regulator of muscle mass—has attracted attention in the field of muscle physiology and regenerative medicine, as potential therapies targeting FST may enhance muscle growth in conditions such as muscular dystrophy and age-related muscle wasting. Additionally, FST plays a vital role in regulating fibrosis and inflammation, making it a promising candidate for therapeutic interventions in fibrotic diseases and metabolic disorders. Advances in recombinant DNA technology have enabled the production of recombinant FST proteins, facilitating the exploration of their therapeutic potential through preclinical and clinical studies. As a result, ongoing research aims to elucidate the precise mechanisms of FST action, optimize its therapeutic applications, and investigate its role in various diseases, paving the way for innovative strategies to manipulate muscle and tissue health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US