Analytical Data
-
Gene name
SFRP2
-
简介
SFRP2 Protein is a soluble crimson-associated protein that promotes tumor development by activating the Wnt/β-catenin signaling pathway. The methylation of SFRP2 Protein DNA is associated with tumor development. SFRP2 Protein, Human (HEK293, His) is the recombinant human-derived SFRP2 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured by its ability to synergize with Wnt-3a to induce Topflash reporter activity in HEK293T human embryonic kidney cells. The ED50 for this effect is <40>2.5×104 units/mg. Measured by its ability to synergize with Wnt-3a to induce Topflash reporter activity in HEK293T human embryonic kidney cells. The ED50 for this effect is 28.27 ng/mL in the presence of 20 ng/mL of Recombinant Mouse Wnt-3a, corresponding to a specific activity is 3.54×104 units/mg.
-
Alternative Names
sFRP-2; SARP-1; Sarp1; Sdf5; Sfrp2; AI851596
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q96HF1
-
Expression Region
L25-C295
-
AA Sequence
LFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
33 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SFRP2 (Secreted Frizzled-Related Protein 2) is a member of the SFRP family, which plays a critical role in modulating the Wnt signaling pathway, a crucial regulator of cell proliferation, differentiation, and fate determination during embryonic development and in various physiological processes. Dysregulation of the Wnt pathway, often linked to aberrant expression of SFRP2, is implicated in several diseases, including cancer, cardiovascular disorders, and fibrosis. Research has demonstrated that SFRP2 can act as both a tumor suppressor and an oncogene, depending on the cellular context, which complicates its role in disease progression. Furthermore, studies have indicated that SFRP2 may influence processes such as angiogenesis and tissue regeneration, making it a target of interest for therapeutic interventions. The recombinant production of SFRP2 protein allows for in-depth study of its structural and functional properties, facilitating the exploration of its interactions with Wnt ligands and receptors. Understanding these interactions is vital for revealing how SFRP2 modulates cellular signaling and contributes to developmental and pathological processes, paving the way for potential clinical applications in regenerative medicine and cancer therapy.











